SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF022969-1|AAB69894.3|  391|Caenorhabditis elegans Hypothetical ...    27   6.9  
AF025472-2|AAB71074.2|  625|Caenorhabditis elegans Hypothetical ...    27   9.1  
AF025472-1|AAY43980.1|  832|Caenorhabditis elegans Hypothetical ...    27   9.1  
AC006614-1|AAF39762.2|  472|Caenorhabditis elegans Hypothetical ...    27   9.1  

>AF022969-1|AAB69894.3|  391|Caenorhabditis elegans Hypothetical
           protein C29G2.5 protein.
          Length = 391

 Score = 27.5 bits (58), Expect = 6.9
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 377 LRKVSGLKTSYALPDMSSVFLKGFDKKATSSK 472
           L ++     S  LPD +S+FL GF+K   + K
Sbjct: 122 LHEIPQAGRSETLPDKASIFLPGFEKVVPNEK 153


>AF025472-2|AAB71074.2|  625|Caenorhabditis elegans Hypothetical
           protein ZK250.5a protein.
          Length = 625

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -1

Query: 456 FLSKPFRNTEDMSGNAYDVF 397
           FL +PFR  ED+S N  D++
Sbjct: 576 FLGEPFRRVEDISSNQPDIW 595


>AF025472-1|AAY43980.1|  832|Caenorhabditis elegans Hypothetical
           protein ZK250.5b protein.
          Length = 832

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -1

Query: 456 FLSKPFRNTEDMSGNAYDVF 397
           FL +PFR  ED+S N  D++
Sbjct: 783 FLGEPFRRVEDISSNQPDIW 802


>AC006614-1|AAF39762.2|  472|Caenorhabditis elegans Hypothetical
           protein C34H3.1 protein.
          Length = 472

 Score = 27.1 bits (57), Expect = 9.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -2

Query: 515 PKFSIAE*DSGPFVFLNSLPFYQN 444
           P +S+A  DSG  VF+ SL F  N
Sbjct: 38  PDYSLASTDSGTTVFIRSLVFVDN 61


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,898,133
Number of Sequences: 27780
Number of extensions: 235022
Number of successful extensions: 509
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 499
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 509
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1134321766
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).