SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   156   1e-38
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   156   1e-38
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       156   1e-38
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       156   1e-38
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       156   1e-38
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   156   1e-38
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   155   3e-38
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       153   9e-38
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   148   3e-36
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   123   1e-28
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   123   1e-28
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   122   3e-28
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   122   3e-28
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   117   6e-27
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   103   1e-22
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...    72   4e-13
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...    56   1e-08
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...    42   3e-04
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    38   0.005
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    34   0.067
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    34   0.067
Z72517-8|CAA96697.2| 1883|Caenorhabditis elegans Hypothetical pr...    31   0.63 
Z72503-12|CAA96600.2| 1883|Caenorhabditis elegans Hypothetical p...    31   0.63 
Z72503-5|CAI79155.1|  513|Caenorhabditis elegans Hypothetical pr...    31   0.63 
Z47356-8|CAD27185.1|  477|Caenorhabditis elegans Hypothetical pr...    31   0.83 
Z47075-8|CAA87381.2|  477|Caenorhabditis elegans Hypothetical pr...    31   0.83 
Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical pr...    30   1.5  
AL132864-1|CAB63392.1|  613|Caenorhabditis elegans Hypothetical ...    29   3.3  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   5.9  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    27   7.7  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    27   7.7  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    27   7.7  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    27   7.7  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  156 bits (378), Expect = 1e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 161


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  156 bits (378), Expect = 1e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 161


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  156 bits (378), Expect = 1e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 161


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  156 bits (378), Expect = 1e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 161


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  156 bits (378), Expect = 1e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 161


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  156 bits (378), Expect = 1e-38
 Identities = 82/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 161


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  155 bits (375), Expect = 3e-38
 Identities = 81/134 (60%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (246), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  153 bits (371), Expect = 9e-38
 Identities = 79/134 (58%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  103 bits (246), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVT 161


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  148 bits (359), Expect = 3e-36
 Identities = 78/132 (59%), Positives = 86/132 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPK+   KMT 
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNREKMTQ 121

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 122 IMF-ETFNTPAM 132



 Score =  102 bits (244), Expect = 2e-22
 Identities = 54/93 (58%), Positives = 60/93 (64%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL +AP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
           EK     + +TF TP    V IQ VL  +   R
Sbjct: 117 EKMTQI-MFETFNTPA-MYVNIQAVLSLYASGR 147


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  123 bits (296), Expect = 1e-28
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AK 271
           +K
Sbjct: 61  SK 62



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKI 342
           EAQSKRG LTLKYPIEHGIVTNWDDMEKI
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  123 bits (296), Expect = 1e-28
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AK 271
           +K
Sbjct: 61  SK 62



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKI 342
           EAQSKRG LTLKYPIEHGIVTNWDDMEKI
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  122 bits (293), Expect = 3e-28
 Identities = 55/62 (88%), Positives = 59/62 (95%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AK 271
           +K
Sbjct: 61  SK 62



 Score = 64.5 bits (150), Expect = 6e-11
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKI 342
           EAQSKRG LTLKYPIEHGIVTNWDDMEKI
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  122 bits (293), Expect = 3e-28
 Identities = 55/62 (88%), Positives = 59/62 (95%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AK 271
           +K
Sbjct: 61  SK 62



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 25/26 (96%), Positives = 25/26 (96%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDM 333
           EAQSKRG LTLKYPIEHGIVTNWDDM
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDM 83


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  117 bits (282), Expect = 6e-27
 Identities = 64/116 (55%), Positives = 70/116 (60%)
 Frame = +2

Query: 140 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXL 319
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   ++K                
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 64

Query: 320 TGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
                 +             PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 65  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF-ETFNTPAM 119



 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 44  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 103

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 104 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 147


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  103 bits (247), Expect = 1e-22
 Identities = 58/106 (54%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 14  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 73

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G++
Sbjct: 74  EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGVVLDSGDGVT 117



 Score = 63.3 bits (147), Expect = 1e-10
 Identities = 39/90 (43%), Positives = 44/90 (48%)
 Frame = +2

Query: 218 MVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPV 397
           MVGMGQKDSYVG   ++K                      +             PEEHPV
Sbjct: 1   MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 60

Query: 398 LLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           LLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 61  LLTEAPLNPKANREKMTQIMF-ETFNTPAM 89


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 43/127 (33%), Positives = 61/127 (48%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G +  +       
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIGPKAESNRGLFSI 70

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           + +  I         PEEHPVLLT+APLNP     +   I F +
Sbjct: 71  EYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNRERSAEIFF-E 129

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 130 TFNVPAL 136



 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 1/107 (0%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF-YNELGVAPRGTPSPAH*GSPQPQGH 432
           +A+S RG  +++YP+EHGIV NW DMEKIW + F  ++L + P   P         P  +
Sbjct: 60  KAESNRGLFSIEYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKN 119

Query: 433 REKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           RE+       +TF  P    + +Q VL  +   R      DS  G++
Sbjct: 120 RERSAEIFF-ETFNVPA-LYIQMQAVLSLYATGRTTGVVLDSGDGVT 164


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 41/127 (32%), Positives = 59/127 (46%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +VVDNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VG     +R   
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEECSQLRQML 68

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                           +  +    FG  P  +     P+E  +LLTE PLNP +   KM 
Sbjct: 69  DINYPMDNGIVRNWDDMAHVWDHTFG--PEKLD--IDPKECKLLLTEPPLNPNSNREKMF 124

Query: 449 HIMFPKH 469
            +MF ++
Sbjct: 125 QVMFEQY 131



 Score = 51.6 bits (118), Expect = 4e-07
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 1/104 (0%)
 Frame = +1

Query: 214 RDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LGVAPRGT 390
           R G    + L+   E    R  L + YP+++GIV NWDDM  +W HTF  E L + P+  
Sbjct: 46  RVGNIEIKDLMVGEECSQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKEC 105

Query: 391 PSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLLAF 522
                     P  +REK   + V    Y      V +Q VL  +
Sbjct: 106 KLLLTEPPLNPNSNREK--MFQVMFEQYGFNSIYVAVQAVLTLY 147


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +1

Query: 283 TLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           T+KYPI HGIV +WD ME+ W    +  L   P
Sbjct: 80  TVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEP 112



 Score = 36.7 bits (81), Expect = 0.013
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           M   ++ A V+DNG+G  K G+AG+  P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36



 Score = 28.7 bits (61), Expect = 3.3
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PE+H  LLTE PLN          IMF + F  P +
Sbjct: 112 PEDHFFLLTEPPLNTPENREYTAEIMF-ESFNVPGL 146


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 37.9 bits (84), Expect = 0.005
 Identities = 19/37 (51%), Positives = 23/37 (62%)
 Frame = +2

Query: 374 SPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPA 484
           S P EHPVL +E+  N +A   K+T IMF K F  PA
Sbjct: 119 SNPSEHPVLFSESSWNDRARREKLTEIMFEK-FQVPA 154



 Score = 33.5 bits (73), Expect = 0.12
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTF 357
           PIE G V NWD  ++IW  TF
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF 82


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 34.3 bits (75), Expect = 0.067
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTF 357
           PIE G V NWD  ++IW  TF
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF 82


>Z72517-8|CAA96697.2| 1883|Caenorhabditis elegans Hypothetical protein
            C26C6.1a protein.
          Length = 1883

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +2

Query: 350  IPSTMSWVSPPEEHPVLLTEAPL-NPKATERKMTHIMF 460
            + S  S VS P +HP +  E P+  PKA + K  +I+F
Sbjct: 1422 VQSQTSSVSTPPQHPSISAEMPIMTPKAVKSKSGYILF 1459


>Z72503-12|CAA96600.2| 1883|Caenorhabditis elegans Hypothetical
            protein C26C6.1a protein.
          Length = 1883

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +2

Query: 350  IPSTMSWVSPPEEHPVLLTEAPL-NPKATERKMTHIMF 460
            + S  S VS P +HP +  E P+  PKA + K  +I+F
Sbjct: 1422 VQSQTSSVSTPPQHPSISAEMPIMTPKAVKSKSGYILF 1459


>Z72503-5|CAI79155.1|  513|Caenorhabditis elegans Hypothetical
           protein C26C6.1b protein.
          Length = 513

 Score = 31.1 bits (67), Expect = 0.63
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +2

Query: 350 IPSTMSWVSPPEEHPVLLTEAPL-NPKATERKMTHIMF 460
           + S  S VS P +HP +  E P+  PKA + K  +I+F
Sbjct: 52  VQSQTSSVSTPPQHPSISAEMPIMTPKAVKSKSGYILF 89


>Z47356-8|CAD27185.1|  477|Caenorhabditis elegans Hypothetical
           protein E02H1.7 protein.
          Length = 477

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +3

Query: 369 GCRPPRNTQSCSLRLPSTPRPQRE 440
           GCR  R+  SCS   P+ PRPQ E
Sbjct: 158 GCRRIRSRPSCSTSTPTPPRPQVE 181


>Z47075-8|CAA87381.2|  477|Caenorhabditis elegans Hypothetical
           protein E02H1.7 protein.
          Length = 477

 Score = 30.7 bits (66), Expect = 0.83
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +3

Query: 369 GCRPPRNTQSCSLRLPSTPRPQRE 440
           GCR  R+  SCS   P+ PRPQ E
Sbjct: 158 GCRRIRSRPSCSTSTPTPPRPQVE 181


>Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical
           protein M110.1 protein.
          Length = 499

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 15/29 (51%), Positives = 17/29 (58%)
 Frame = +1

Query: 190 RGKAPPSGRDGRYGTEGLLCRSEAQSKRG 276
           RGKA  +GRDGR G EG       Q +RG
Sbjct: 216 RGKAGHTGRDGRPGLEGTPGTRGVQGERG 244


>AL132864-1|CAB63392.1|  613|Caenorhabditis elegans Hypothetical
           protein Y53H1A.1 protein.
          Length = 613

 Score = 28.7 bits (61), Expect = 3.3
 Identities = 12/25 (48%), Positives = 13/25 (52%)
 Frame = +1

Query: 382 RGTPSPAH*GSPQPQGHREKDDPYH 456
           RG P PAH G   P GH  +  P H
Sbjct: 111 RGAPPPAHHGHFGPPGHHFQGPPQH 135


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +2

Query: 140 KAGFAGDDAPRAVFPSIVGRPRHQG 214
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
           beta protein.
          Length = 1418

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 165 ASSPAKPALHIPEPLSTTNAATSS 94
           +SSPA P++  P P +T++ +TSS
Sbjct: 652 SSSPATPSISGPPPCATSSGSTSS 675


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
           beta homolog EGL-8 protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 165 ASSPAKPALHIPEPLSTTNAATSS 94
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
           defective protein 8,isoform a protein.
          Length = 1419

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 165 ASSPAKPALHIPEPLSTTNAATSS 94
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
           defective protein 8,isoform b protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 7.7
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 165 ASSPAKPALHIPEPLSTTNAATSS 94
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,563,598
Number of Sequences: 27780
Number of extensions: 420793
Number of successful extensions: 1490
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1266
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1476
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1279376318
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).