SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical pr...   154   4e-38
Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical pr...   154   4e-38
X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.       154   4e-38
X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.       154   4e-38
X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.       154   4e-38
U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4...   154   4e-38
Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical pr...   153   1e-37
X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.       151   3e-37
Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical pr...   146   9e-36
J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein ( C.ele...   136   2e-32
J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein ( C.ele...   136   2e-32
J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein ( C.ele...   134   4e-32
J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein ( C.ele...   134   4e-32
U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4...   123   1e-28
U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4...   123   1e-28
AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical...    82   4e-16
Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical pr...    69   4e-12
AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 comple...    64   8e-11
AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical ...    48   4e-06
Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical pr...    34   0.074
U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related p...    34   0.074
AC084158-40|AAM15618.2|  354|Caenorhabditis elegans Hypothetical...    33   0.13 
AC084158-39|AAM15616.2|  483|Caenorhabditis elegans Hypothetical...    33   0.13 
AC084158-38|AAM15617.2|  488|Caenorhabditis elegans Hypothetical...    33   0.13 
AC084158-37|AAM15615.2|  486|Caenorhabditis elegans Hypothetical...    33   0.13 
Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical pr...    32   0.40 
Z92812-9|CAM84813.1|  338|Caenorhabditis elegans Hypothetical pr...    30   1.2  
U41278-7|AAT81193.1|  680|Caenorhabditis elegans Hypothetical pr...    30   1.6  
U41278-6|AAK31510.3|  771|Caenorhabditis elegans Hypothetical pr...    30   1.6  
AL034393-13|CAA22317.1|  340|Caenorhabditis elegans Hypothetical...    30   1.6  
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    29   2.1  
Z92825-3|CAB07311.1|  531|Caenorhabditis elegans Hypothetical pr...    29   3.7  
Z98877-16|CAH60800.1|  975|Caenorhabditis elegans Hypothetical p...    28   4.9  
Z98877-15|CAB63407.3|  572|Caenorhabditis elegans Hypothetical p...    28   4.9  
Z81470-4|CAB03879.1|  550|Caenorhabditis elegans Hypothetical pr...    28   6.4  
AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical ...    28   6.4  
Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical pr...    27   8.5  
AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase...    27   8.5  
AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase...    27   8.5  
AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying de...    27   8.5  
AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying de...    27   8.5  

>Z81584-6|CAB04678.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.6 protein.
          Length = 376

 Score =  154 bits (374), Expect = 4e-38
 Identities = 80/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>Z81584-4|CAB04676.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.4 protein.
          Length = 376

 Score =  154 bits (374), Expect = 4e-38
 Identities = 80/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>X16799-1|CAA34720.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  154 bits (374), Expect = 4e-38
 Identities = 80/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>X16798-1|CAA34719.1|  375|Caenorhabditis elegans actin protein.
          Length = 375

 Score =  154 bits (374), Expect = 4e-38
 Identities = 80/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>X16796-1|CAA34717.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  154 bits (374), Expect = 4e-38
 Identities = 80/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>U64601-5|AAB04575.1|  376|Caenorhabditis elegans Actin protein 4,
           isoform a protein.
          Length = 376

 Score =  154 bits (374), Expect = 4e-38
 Identities = 80/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>Z81584-5|CAB04675.1|  376|Caenorhabditis elegans Hypothetical
           protein T04C12.5 protein.
          Length = 376

 Score =  153 bits (371), Expect = 1e-37
 Identities = 79/131 (60%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>X16797-1|CAA34718.1|  376|Caenorhabditis elegans actin protein.
          Length = 376

 Score =  151 bits (367), Expect = 3e-37
 Identities = 77/131 (58%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++VAAL++DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALILDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>Z83241-1|CAB05817.1|  375|Caenorhabditis elegans Hypothetical
           protein T25C8.2 protein.
          Length = 375

 Score =  146 bits (355), Expect = 9e-36
 Identities = 76/129 (58%), Positives = 81/129 (62%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +EE+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P++   KMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNREKMTQ 121

Query: 432 IMFETFNTP 458
           IMFETFNTP
Sbjct: 122 IMFETFNTP 130



 Score =  122 bits (295), Expect = 2e-28
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKSNREK 118


>J01044-1|AAA27889.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene III, 5' end. ).
          Length = 86

 Score =  136 bits (328), Expect = 2e-32
 Identities = 62/63 (98%), Positives = 63/63 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKR 254
           SKR
Sbjct: 61  SKR 63



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 22/25 (88%), Positives = 24/25 (96%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKI 322
           ++ ILTLKYPIEHGIVTNWDDMEKI
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKI 86


>J01042-1|AAA27887.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene I, 5' end. ).
          Length = 86

 Score =  136 bits (328), Expect = 2e-32
 Identities = 62/63 (98%), Positives = 63/63 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKR 254
           SKR
Sbjct: 61  SKR 63



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 22/25 (88%), Positives = 24/25 (96%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKI 322
           ++ ILTLKYPIEHGIVTNWDDMEKI
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKI 86


>J01046-1|AAA27890.1|   86|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene IV, 5' end. ).
          Length = 86

 Score =  134 bits (325), Expect = 4e-32
 Identities = 61/63 (96%), Positives = 63/63 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKR 254
           SKR
Sbjct: 61  SKR 63



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 22/25 (88%), Positives = 24/25 (96%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKI 322
           ++ ILTLKYPIEHGIVTNWDDMEKI
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKI 86


>J01043-1|AAA27888.1|   83|Caenorhabditis elegans protein (
           C.elegans (nematode)actin gene II, 5' end. ).
          Length = 83

 Score =  134 bits (325), Expect = 4e-32
 Identities = 61/63 (96%), Positives = 63/63 (100%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKR 254
           SKR
Sbjct: 61  SKR 63



 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 19/22 (86%), Positives = 21/22 (95%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDM 313
           ++ ILTLKYPIEHGIVTNWDDM
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDM 83


>U64601-7|AAK77622.1|  332|Caenorhabditis elegans Actin protein 4,
           isoform b protein.
          Length = 332

 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 18  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 75



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 37/87 (42%), Positives = 39/87 (44%)
 Frame = +3

Query: 198 MVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQS 377
           MVGMGQKDSYVGDEAQSKR                     +             P     
Sbjct: 1   MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 60

Query: 378 CLLRLPSTPRATERKMTQIMFETFNTP 458
            L   P  P+A   KMTQIMFETFNTP
Sbjct: 61  LLTEAPLNPKANREKMTQIMFETFNTP 87


>U64601-6|AAT92068.1|  362|Caenorhabditis elegans Actin protein 4,
           isoform c protein.
          Length = 362

 Score =  123 bits (296), Expect = 1e-28
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 48  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 105



 Score =  116 bits (278), Expect = 2e-26
 Identities = 62/113 (54%), Positives = 65/113 (57%)
 Frame = +3

Query: 120 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXL 299
           +AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR               
Sbjct: 5   RAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 64

Query: 300 TGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                 +             P      L   P  P+A   KMTQIMFETFNTP
Sbjct: 65  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 117


>AL132949-19|CAB70110.2|  374|Caenorhabditis elegans Hypothetical
           protein Y53F4B.22 protein.
          Length = 374

 Score = 81.8 bits (193), Expect = 4e-16
 Identities = 33/58 (56%), Positives = 46/58 (79%), Gaps = 1/58 (1%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           + + +++YP+EHGIV NW DMEKIW + F  ++L++ PEEHPVLLT+A LNP  NRE+
Sbjct: 65  RGLFSIEYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNRER 122



 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 38/124 (30%), Positives = 54/124 (43%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAG+  P+  F + VGRP++  VM G    D ++G +A+S R     
Sbjct: 11  VVIDNGSGVIKAGFAGEQQPKVRFANFVGRPKYHRVMAGGLDGDIFIGPKAESNRGLFSI 70

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           + +  I         P      L   P  P     +  +I FET
Sbjct: 71  EYPMEHGIVNNWSDMEKIWEYIFGQDQLKIFPEEHPVLLTDAPLNPLKNRERSAEIFFET 130

Query: 447 FNTP 458
           FN P
Sbjct: 131 FNVP 134


>Z71181-1|CAA94894.1|  395|Caenorhabditis elegans Hypothetical
           protein K07C5.1 protein.
          Length = 395

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 30/61 (49%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNRE 418
           ++ + +L + YP+++GIV NWDDM  +W HTF  E L + P+E  +LLTE  LNP  NRE
Sbjct: 62  SQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPLNPNSNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 39/127 (30%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKR--- 254
           +VVDNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VG+E    R   
Sbjct: 9   IVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEECSQLRQML 68

Query: 255 -VXXXXXXXXXXXXXLTGMTW-RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMT 428
            +                  W   FG  P  +     P+  +  L   P  P +   KM 
Sbjct: 69  DINYPMDNGIVRNWDDMAHVWDHTFG--PEKLDI--DPKECKLLLTEPPLNPNSNREKMF 124

Query: 429 QIMFETF 449
           Q+MFE +
Sbjct: 125 QVMFEQY 131


>AC024200-9|AAF36012.1|  425|Caenorhabditis elegans Arp2/3 complex
           component protein 1 protein.
          Length = 425

 Score = 64.1 bits (149), Expect = 8e-11
 Identities = 28/52 (53%), Positives = 33/52 (63%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           T+KYPI HGIV +WD ME+ W    +  LR  PE+H  LLTE  LN   NRE
Sbjct: 80  TVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLTEPPLNTPENRE 131



 Score = 36.7 bits (81), Expect = 0.014
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           M   ++ A V+DNG+G  K G+AG+  P+ + PS +
Sbjct: 1   MSAHQLPACVIDNGTGYTKLGYAGNTEPQFIIPSAI 36


>AC006833-3|AAF60947.2|  436|Caenorhabditis elegans Hypothetical
           protein ZK616.4 protein.
          Length = 436

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 278 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+S N +  REK
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREK 141



 Score = 33.5 bits (73), Expect = 0.13
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>Z46676-5|CAA86667.3|  418|Caenorhabditis elegans Hypothetical
           protein C08B11.6 protein.
          Length = 418

 Score = 34.3 bits (75), Expect = 0.074
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTF 337
           PIE G V NWD  ++IW  TF
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF 82


>U24189-2|AAC47513.1|  418|Caenorhabditis elegans actin-related
           protein-like protein.
          Length = 418

 Score = 34.3 bits (75), Expect = 0.074
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTF 337
           PIE G V NWD  ++IW  TF
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF 82


>AC084158-40|AAM15618.2|  354|Caenorhabditis elegans Hypothetical
           protein Y69A2AR.1d protein.
          Length = 354

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL---AFKPVLLAVRLPSVPPG 524
           +P    + CL+ L    + T +++   +   FN P+H+R     FKP  + V L    P 
Sbjct: 158 TPECEAEDCLIELMFIKKWTCKQLDYNICTEFNQPQHLRRLVHMFKPTDITVSL-HFGPY 216

Query: 525 IRAGTSREPVFFHN 566
           I + T+ EP   HN
Sbjct: 217 IPSATAHEPNSMHN 230


>AC084158-39|AAM15616.2|  483|Caenorhabditis elegans Hypothetical
           protein Y69A2AR.1b protein.
          Length = 483

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL---AFKPVLLAVRLPSVPPG 524
           +P    + CL+ L    + T +++   +   FN P+H+R     FKP  + V L    P 
Sbjct: 158 TPECEAEDCLIELMFIKKWTCKQLDYNICTEFNQPQHLRRLVHMFKPTDITVSL-HFGPY 216

Query: 525 IRAGTSREPVFFHN 566
           I + T+ EP   HN
Sbjct: 217 IPSATAHEPNSMHN 230


>AC084158-38|AAM15617.2|  488|Caenorhabditis elegans Hypothetical
           protein Y69A2AR.1c protein.
          Length = 488

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL---AFKPVLLAVRLPSVPPG 524
           +P    + CL+ L    + T +++   +   FN P+H+R     FKP  + V L    P 
Sbjct: 163 TPECEAEDCLIELMFIKKWTCKQLDYNICTEFNQPQHLRRLVHMFKPTDITVSL-HFGPY 221

Query: 525 IRAGTSREPVFFHN 566
           I + T+ EP   HN
Sbjct: 222 IPSATAHEPNSMHN 235


>AC084158-37|AAM15615.2|  486|Caenorhabditis elegans Hypothetical
           protein Y69A2AR.1a protein.
          Length = 486

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL---AFKPVLLAVRLPSVPPG 524
           +P    + CL+ L    + T +++   +   FN P+H+R     FKP  + V L    P 
Sbjct: 161 TPECEAEDCLIELMFIKKWTCKQLDYNICTEFNQPQHLRRLVHMFKPTDITVSL-HFGPY 219

Query: 525 IRAGTSREPVFFHN 566
           I + T+ EP   HN
Sbjct: 220 IPSATAHEPNSMHN 233


>Z82258-1|CAB05122.2|  906|Caenorhabditis elegans Hypothetical
           protein C27H2.2a protein.
          Length = 906

 Score = 31.9 bits (69), Expect = 0.40
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = -2

Query: 327 CQIFSMSSQLVTIPC-SMGYLRVRILFCSVPHLLHKSPSVP-YRPSRPD 187
           CQ+FS   QLVT+   SMG ++++++   +P L  KS + P   P+ P+
Sbjct: 251 CQLFSSQPQLVTMNLNSMGTIKLQLVVTWLPLLASKSSTKPTIAPNPPE 299


>Z92812-9|CAM84813.1|  338|Caenorhabditis elegans Hypothetical
           protein T03E6.9 protein.
          Length = 338

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = -1

Query: 511 DGRRTARSTGLNAKRTWRGVLNVSNMIWVIFLSVALGVEGSLSKQD-WVFLGGDTQLIV- 338
           + R       LN +R + G+L    ++++IF+ V + V  +L   D  +   G   L++ 
Sbjct: 233 ESRNIVSKETLNMQRNFTGILIYQALVYIIFIIVPVAVISTLFYADIHITDYGLPYLLMI 292

Query: 337 --EGMMPNLLHVIP 302
             +G + N++H++P
Sbjct: 293 CSQGTINNMIHIVP 306


>U41278-7|AAT81193.1|  680|Caenorhabditis elegans Hypothetical
           protein F33G12.6b protein.
          Length = 680

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = -2

Query: 252 FCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEH-HLLRNRPCTYRSHCL 97
           FC +    H++    + P R D      +RG  +++H    RNRPC     C+
Sbjct: 393 FCVIKKSEHENKENAHLPPREDRTLDVTTRGGEKDKHSEYARNRPCAASLPCV 445


>U41278-6|AAK31510.3|  771|Caenorhabditis elegans Hypothetical
           protein F33G12.6a protein.
          Length = 771

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = -2

Query: 252 FCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEH-HLLRNRPCTYRSHCL 97
           FC +    H++    + P R D      +RG  +++H    RNRPC     C+
Sbjct: 393 FCVIKKSEHENKENAHLPPREDRTLDVTTRGGEKDKHSEYARNRPCAASLPCV 445


>AL034393-13|CAA22317.1|  340|Caenorhabditis elegans Hypothetical
           protein Y18D10A.17 protein.
          Length = 340

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
 Frame = -3

Query: 620 GNGRGGKVGYPFR*NGARVVEKHR--FPGSPSTNTGWYGRKAYSEK 489
           G GRGG  GY    NG +   +HR  + G    N G Y R  Y+ +
Sbjct: 283 GRGRGGNRGYGGYNNGYQHQHQHRGGYNGGYRQNNGGYRRGGYAPR 328


>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
           protein T19D12.1 protein.
          Length = 1844

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = -1

Query: 253 LLLCASSPT*ESFCPIPTITP*WRGLPTIEGN-TARGASSPAKPALHIPEPLSTTNAATS 77
           L++ +SS    S     TITP  +G+PT   N      S+P  P   +    STT A ++
Sbjct: 465 LVVSSSSSGSSSTVVTSTITPSTQGVPTSTSNQPTPSTSNPTTPKSTVTASPSTTGATST 524

Query: 76  SS 71
           +S
Sbjct: 525 AS 526


>Z92825-3|CAB07311.1|  531|Caenorhabditis elegans Hypothetical
           protein C13C4.5 protein.
          Length = 531

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 12/44 (27%), Positives = 20/44 (45%)
 Frame = -1

Query: 487 TGLNAKRTWRGVLNVSNMIWVIFLSVALGVEGSLSKQDWVFLGG 356
           T  N    W G++  + M++ I  S   G  G    + W+F+ G
Sbjct: 85  TYYNISDAWAGLIQTTFMVFFIIFSPICGFLGDRYNRKWIFVVG 128


>Z98877-16|CAH60800.1|  975|Caenorhabditis elegans Hypothetical
           protein Y69H2.10b protein.
          Length = 975

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +3

Query: 336 STMSCVSPPRNTQSCLLRLP 395
           ST  C SP  +TQ+C+ RLP
Sbjct: 297 STQVCASPLNSTQTCIPRLP 316


>Z98877-15|CAB63407.3|  572|Caenorhabditis elegans Hypothetical
           protein Y69H2.10a protein.
          Length = 572

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +3

Query: 336 STMSCVSPPRNTQSCLLRLP 395
           ST  C SP  +TQ+C+ RLP
Sbjct: 297 STQVCASPLNSTQTCIPRLP 316


>Z81470-4|CAB03879.1|  550|Caenorhabditis elegans Hypothetical
           protein C14A6.5 protein.
          Length = 550

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 3/63 (4%)
 Frame = -1

Query: 637 VPKTAKEMGVGEKWGIPFGKMGHGLWKNTGSREVPARIPGGT--DGRRTARS-TGLNAKR 467
           VP   +++ + + +     +    LW++ G  E    +PG T  DGR++ +S     A+R
Sbjct: 315 VPYNERKLCILDGYDFTESRAAQKLWEDGGICEKNGYVPGETEGDGRKSEKSGKTCGARR 374

Query: 466 TWR 458
            W+
Sbjct: 375 EWK 377


>AF025453-5|AAY55851.1|  279|Caenorhabditis elegans Hypothetical
           protein C08F1.11 protein.
          Length = 279

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +3

Query: 120 KAGFAGDDAPRAVFPSIVGRPRHQG 194
           KA + G D P+A F  I+G   ++G
Sbjct: 44  KASYLGHDTPQATFREIIGNKEYRG 68


>Z49968-1|CAA90258.2|  499|Caenorhabditis elegans Hypothetical
           protein M110.1 protein.
          Length = 499

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 12/17 (70%), Positives = 13/17 (76%)
 Frame = +2

Query: 170 RGKAPPSGRDGRYGTEG 220
           RGKA  +GRDGR G EG
Sbjct: 216 RGKAGHTGRDGRPGLEG 232


>AF188477-1|AAF01458.1| 1418|Caenorhabditis elegans phospholipase C
           beta protein.
          Length = 1418

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 145 ASSPAKPALHIPEPLSTTNAATSS 74
           +SSPA P++  P P +T++ +TSS
Sbjct: 652 SSSPATPSISGPPPCATSSGSTSS 675


>AF179426-1|AAF05701.1| 1431|Caenorhabditis elegans phospholipase C
           beta homolog EGL-8 protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 145 ASSPAKPALHIPEPLSTTNAATSS 74
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-6|AAL77167.1| 1419|Caenorhabditis elegans Egg laying
           defective protein 8,isoform a protein.
          Length = 1419

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 145 ASSPAKPALHIPEPLSTTNAATSS 74
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


>AF068714-5|AAL77168.1| 1431|Caenorhabditis elegans Egg laying
           defective protein 8,isoform b protein.
          Length = 1431

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = -1

Query: 145 ASSPAKPALHIPEPLSTTNAATSS 74
           +SSPA P++  P P +T++ +TSS
Sbjct: 653 SSSPATPSISGPPPCATSSGSTSS 676


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,616,973
Number of Sequences: 27780
Number of extensions: 442542
Number of successful extensions: 1547
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 1386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1543
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1406256614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).