SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30084
         (658 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   2.6  
AF393494-1|AAL60419.1|  144|Apis mellifera odorant binding prote...    22   4.5  
AF166496-1|AAD51944.1|  144|Apis mellifera pheromone-binding pro...    22   4.5  
AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    21   7.8  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 546 LRYLNITPVSCIFVYFLITFI*LMYFITLCKRI 644
           +R LNI  VS +F  FL   + + Y+I   + I
Sbjct: 396 MRALNIDRVSRVFFPFLFAVLNVTYWIMFAEYI 428


>AF393494-1|AAL60419.1|  144|Apis mellifera odorant binding protein
           ASP1 protein.
          Length = 144

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 629 CNKIH*LNKCDQE 591
           CNKI+ L KC QE
Sbjct: 123 CNKIYNLAKCVQE 135


>AF166496-1|AAD51944.1|  144|Apis mellifera pheromone-binding
           protein ASP1 protein.
          Length = 144

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 629 CNKIH*LNKCDQE 591
           CNKI+ L KC QE
Sbjct: 123 CNKIYNLAKCVQE 135


>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
           opsin protein.
          Length = 371

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 13/30 (43%), Positives = 14/30 (46%)
 Frame = +3

Query: 516 VPTF*TTLCSLRYLNITPVSCIFVYFLITF 605
           VP    T CS  YL  T    IFV  + TF
Sbjct: 189 VPEGFLTSCSFDYLTDTNEIRIFVATIFTF 218


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,914
Number of Sequences: 438
Number of extensions: 3517
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -