Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10444X
         (417 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate isome...    22   2.4  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    20   9.7  

>EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate
           isomerase protein.
          Length = 247

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 9/30 (30%), Positives = 15/30 (50%)
 Frame = +2

Query: 197 GRRPRQGEAGGLQEAVRXAARWLGDKLGSW 286
           G +  + EAG   E V    + + +K+ SW
Sbjct: 127 GEKLEEREAGKTDEVVFRQTKAIANKINSW 156


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 20.2 bits (40), Expect = 9.7
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 141 HEYEGHKFQ 167
           HE++ HKFQ
Sbjct: 75  HEWQDHKFQ 83


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,689
Number of Sequences: 438
Number of extensions: 1259
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10626762
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)