SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             26   0.37 
DQ435334-1|ABD92649.1|  135|Apis mellifera OBP17 protein.              26   0.49 
AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8 ...    23   3.4  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     23   4.5  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    22   6.0  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    22   6.0  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   7.9  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 26.2 bits (55), Expect = 0.37
 Identities = 16/60 (26%), Positives = 29/60 (48%)
 Frame = +1

Query: 457 ALRPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRANAFVPIVEARSL 636
           ALR +Q G+L  R+ A++  I R+T   +  +      R  +L S  ++   P   A ++
Sbjct: 599 ALRDIQSGKLGTRRAAVIYGIPRSTLRNKVYKLAMERERDASLSSTHSHPHEPGAPATTI 658


>DQ435334-1|ABD92649.1|  135|Apis mellifera OBP17 protein.
          Length = 135

 Score = 25.8 bits (54), Expect = 0.49
 Identities = 13/53 (24%), Positives = 25/53 (47%)
 Frame = +1

Query: 442 GRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRA 600
           G  +  +  + EG++ +    +LL I      +  + ENAN +  ++   VRA
Sbjct: 38  GTAQQIIDDINEGKINMDDENVLLFIECTMKKFNVVDENANFNEKISSDIVRA 90


>AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8
           protein.
          Length = 208

 Score = 23.0 bits (47), Expect = 3.4
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = -1

Query: 755 GGKNLVVRLRGLFKTGRPRTTFKL 684
           GGK   +R +  F+ GRP    KL
Sbjct: 15  GGKRKPIRKKRKFELGRPAANTKL 38


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.6 bits (46), Expect = 4.5
 Identities = 9/32 (28%), Positives = 14/32 (43%)
 Frame = -3

Query: 237 DNDDGSPLCSPRRCPANAFPLYRWIRQRRGYP 142
           D   G+P+C       N   L +W   + G+P
Sbjct: 324 DRMQGNPICVQIPWDKNVEALAKWANGQTGFP 355


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 675 GARFQGSCFAH 643
           GARF GSC  H
Sbjct: 427 GARFGGSCLIH 437


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 675 GARFQGSCFAH 643
           GARF GSC  H
Sbjct: 427 GARFGGSCLIH 437


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 13/43 (30%), Positives = 17/43 (39%)
 Frame = +1

Query: 340  GLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRP 468
            G   G+ G    H G +G      +G   + P SG P P   P
Sbjct: 1821 GSQYGQYGAPYDHYGSRGSVGRRSVGSARNIPVSGSPEPPPPP 1863


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 249,171
Number of Sequences: 438
Number of extensions: 5850
Number of successful extensions: 12
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26338809
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).