SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.          26   0.47 
DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    24   1.4  
X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.    23   4.4  
EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2 prot...    23   4.4  
AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2 prot...    23   4.4  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    23   4.4  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    22   5.8  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   7.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   7.7  

>AY656663-1|AAT68000.1|  148|Apis mellifera pteropsin protein.
          Length = 148

 Score = 25.8 bits (54), Expect = 0.47
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -1

Query: 620 ISVFIYIWMPRL*LKTLMDGGEYG*SGGNFMCALKY 513
           ++ F++I+   L L  L   G YG   GN  C++ +
Sbjct: 18  LASFVWIYALSLSLPPLFGWGSYGPEAGNVSCSVSW 53


>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 547 SQGGISCVP*SIHLIKC 497
           S G +SCVP   H+ KC
Sbjct: 153 SSGSVSCVPSVKHVAKC 169


>X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.
          Length = 162

 Score = 22.6 bits (46), Expect = 4.4
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -3

Query: 468 HSNRLSSPSNLTRKPSTGSSCR 403
           H N+ S P+ L R   T + CR
Sbjct: 39  HGNKSSGPNELGRFKHTDACCR 60


>EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 22.6 bits (46), Expect = 4.4
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -3

Query: 468 HSNRLSSPSNLTRKPSTGSSCR 403
           H N+ S P+ L R   T + CR
Sbjct: 44  HGNKSSGPNELGRFKHTDACCR 65


>AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 22.6 bits (46), Expect = 4.4
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -3

Query: 468 HSNRLSSPSNLTRKPSTGSSCR 403
           H N+ S P+ L R   T + CR
Sbjct: 44  HGNKSSGPNELGRFKHTDACCR 65


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 22.6 bits (46), Expect = 4.4
 Identities = 7/17 (41%), Positives = 14/17 (82%)
 Frame = -2

Query: 112 SRRNNRPKAHDQLNNNE 62
           +++NN+  A++Q NNN+
Sbjct: 433 NQKNNKKNANNQKNNNQ 449


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 22.2 bits (45), Expect = 5.8
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = +1

Query: 685 TLGTLHNRFATGTPPLVISIPQRSPN 762
           +LG L     TGTPP     P ++ N
Sbjct: 550 SLGVLMFELLTGTPPFTGGDPMKTYN 575


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.8 bits (44), Expect = 7.7
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -3

Query: 63  RKRSTVQRNVIRRKSATCV 7
           R++S  QRNVIR   A  V
Sbjct: 274 RRKSAAQRNVIRMLVAVVV 292


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 7.7
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -2

Query: 244 ISTRHNNNELEILVNIASILQHPQVRVTH 158
           +S  HN N   +  N+A+ + H Q  V H
Sbjct: 675 LSPDHNGNYSCVARNLAAEVSHTQRLVVH 703


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 251,512
Number of Sequences: 438
Number of extensions: 6003
Number of successful extensions: 14
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25489170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).