SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       45   6e-07
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       29   0.034
AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     24   1.7  
AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective...    23   2.2  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    22   5.1  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    22   6.8  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   6.8  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 45.2 bits (102), Expect = 6e-07
 Identities = 20/54 (37%), Positives = 36/54 (66%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           Q +E+F+   L+  +L  I   G++KP+ +Q+ A+   + GRD++A AQ+G+GK
Sbjct: 193 QPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSGK 246



 Score = 29.5 bits (63), Expect = 0.034
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 9/68 (13%)
 Frame = +2

Query: 254 KTATFSISIL-----QQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKCH 406
           KTA F++ I+     + +D  +     E Q +I++PTREL  QI + ++    +   K  
Sbjct: 246 KTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSILKTV 305

Query: 407 ACIGGTNV 430
              GGT+V
Sbjct: 306 VAYGGTSV 313



 Score = 24.2 bits (50), Expect = 1.3
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +1

Query: 478 ALQGRVYDMIIVVRFHANTIKLFVLDEAD 564
           A  GR+ D +   R   ++++  VLDEAD
Sbjct: 329 ATPGRLLDFVEKGRVKFSSVQFLVLDEAD 357


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 29.5 bits (63), Expect = 0.034
 Identities = 27/108 (25%), Positives = 45/108 (41%), Gaps = 6/108 (5%)
 Frame = +2

Query: 125 PQRRIVERHIRLWF*KTFC----NPATRNNALHPRTRCYRS-SPVRNWKTATFSISILQQ 289
           P +++    I  WF  TFC    N AT  NA+      ++    V N K A +++  ++ 
Sbjct: 521 PDKQLTLNEIYNWFQNTFCYFRRNAATWKNAVRHNLSLHKCFMRVENVKGAVWTVDEVEF 580

Query: 290 ID-TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
                 R C      P++  +  +       GD LNA   A +G +N+
Sbjct: 581 YKRRPQRACSTTGGVPSK--SPTLTHSPTMYGDALNANLQAALGDSNM 626


>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +1

Query: 469 TWWALQGRVYDMIIVVRFH 525
           T W++ G V+D+I +  FH
Sbjct: 165 TRWSISGTVFDLINIHLFH 183


>AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective
           protein-1 protein.
          Length = 128

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -3

Query: 431 GHWCHQCKHGI*HSS 387
           G  CH+CK+GI  SS
Sbjct: 40  GDSCHKCKYGIAMSS 54


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +1

Query: 409 LHWWHQCP 432
           LH WH CP
Sbjct: 470 LHHWHHCP 477


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = +3

Query: 618 DGWSADCFKSIFTLLLTMAWIECYLG 695
           D W + C   +F  L+  A +  Y+G
Sbjct: 277 DVWMSSCSVFVFLSLMEFAVVNNYMG 302


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = -1

Query: 499 HIHDPGVPTTYMNT 458
           H H+PG P T + T
Sbjct: 647 HPHEPGAPATTITT 660


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 223,541
Number of Sequences: 438
Number of extensions: 5168
Number of successful extensions: 18
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).