SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30048
         (717 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    24   1.2  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    23   2.2  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   5.0  
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        21   8.8  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = -1

Query: 597 GVLISGNCQPASLCYR*EPKVESSFHH 517
           GV + G+    +L ++ +PKVES+FH+
Sbjct: 504 GVNLKGHAHWLTLHFK-DPKVESAFHN 529


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = -3

Query: 712 QASSTSGSTPVKHTNQGLPLQPHQGMVWLNLKEPSTAA 599
           QA+S   S P  H  Q    Q HQG+V   L +   AA
Sbjct: 211 QAASQQ-SQPGMHPRQQQQAQQHQGVVTSPLSQQQQAA 247


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 5/14 (35%), Positives = 11/14 (78%)
 Frame = -1

Query: 393  LSSWFFHFNISRFC 352
            +S+W +H N+++ C
Sbjct: 1674 MSTWGYHHNVNKHC 1687


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = -3

Query: 340 ESRMILLPGLFLRFSL 293
           ES  +LLP ++LR++L
Sbjct: 249 ESEDVLLPSVYLRWNL 264


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,720
Number of Sequences: 438
Number of extensions: 3239
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22170330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).