SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    23   2.5  
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      23   3.3  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   7.5  
DQ855485-1|ABH88172.1|  128|Apis mellifera chemosensory protein ...    21   10.0 
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    21   10.0 
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    21   10.0 
AJ973400-1|CAJ01447.1|  128|Apis mellifera hypothetical protein ...    21   10.0 

>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
           opsin protein.
          Length = 371

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +3

Query: 231 GRRVPDDFLRGCSF 272
           GR VP+ FL  CSF
Sbjct: 186 GRFVPEGFLTSCSF 199


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -2

Query: 130 SSTVPRKAESGSPLMPSHFCNMSQSS 53
           SS +P  AES +   P H+   S S+
Sbjct: 28  SSGIPHSAESSASNSPDHYERFSPST 53


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +1

Query: 229 WEDACLMTFSEAVASPLRNV 288
           W  A  +T  EAV SPL +V
Sbjct: 474 WGSASDVTLDEAVKSPLGSV 493


>DQ855485-1|ABH88172.1|  128|Apis mellifera chemosensory protein 4
           protein.
          Length = 128

 Score = 21.4 bits (43), Expect = 10.0
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = +3

Query: 210 TPSTR*VGRRVPDDFLRGCSFSLEKCKKKLD 302
           TP    + R +PD     CS   EK KK  D
Sbjct: 57  TPDAAELKRNLPDALENECSPCSEKQKKIAD 87


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.4 bits (43), Expect = 10.0
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = -2

Query: 286 HFSREKLQPRRKSSGTRLPTHLVDGVAFSATP*LQLSPVP 167
           H + ++   R  S     P+ L DG  F  +  +   P+P
Sbjct: 403 HLTPKRFHSRAASKEDLSPSSLADGARFGGSCLIHGPPLP 442


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.4 bits (43), Expect = 10.0
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = -2

Query: 286 HFSREKLQPRRKSSGTRLPTHLVDGVAFSATP*LQLSPVP 167
           H + ++   R  S     P+ L DG  F  +  +   P+P
Sbjct: 403 HLTPKRFHSRAASKEDLSPSSLADGARFGGSCLIHGPPLP 442


>AJ973400-1|CAJ01447.1|  128|Apis mellifera hypothetical protein
           protein.
          Length = 128

 Score = 21.4 bits (43), Expect = 10.0
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = +3

Query: 210 TPSTR*VGRRVPDDFLRGCSFSLEKCKKKLD 302
           TP    + R +PD     CS   EK KK  D
Sbjct: 57  TPDAAELKRNLPDALENECSPCSEKQKKIAD 87


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,236
Number of Sequences: 438
Number of extensions: 5443
Number of successful extensions: 9
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25125039
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).