SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    27   0.13 
U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive o...    24   1.6  
AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin ...    24   1.6  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   2.1  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    23   2.8  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    23   2.8  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   3.7  

>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
            protein.
          Length = 1143

 Score = 27.5 bits (58), Expect = 0.13
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = +3

Query: 567  GPAMASYPLRDVWHPKVKVLKRAPFSEISKL 659
            GP     P R  WH ++  +KR P  E  K+
Sbjct: 972  GPGTGIAPFRGFWHHRLAEIKRRPDLEYGKV 1002


>U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive
           opsin protein.
          Length = 377

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -1

Query: 75  IDGALTSYQSLRVNGSTIFFLTPF 4
           IDG L S Q+  +   T F++TPF
Sbjct: 162 IDGRLNSKQAAVIIAFTWFWVTPF 185


>AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin
           protein.
          Length = 377

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -1

Query: 75  IDGALTSYQSLRVNGSTIFFLTPF 4
           IDG L S Q+  +   T F++TPF
Sbjct: 162 IDGRLNSKQAAVIIAFTWFWVTPF 185


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 2/29 (6%)
 Frame = +1

Query: 61  QGSVYVQQEASRHH--ACQPYPGNENCFG 141
           Q S+Y+QQ+  +HH  +   +  N+  FG
Sbjct: 94  QHSLYLQQQQQQHHQDSSSEHASNQERFG 122


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 10/37 (27%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
 Frame = -3

Query: 610 GCQTSRRG*DAMA-GPSRCPWQWSQEINLFTTSLSQS 503
           GC   +     M+  P+R P+QW   ++   +S S +
Sbjct: 400 GCGAGKENYQTMSRDPARTPFQWDDSVSAGFSSSSNT 436


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 10/37 (27%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
 Frame = -3

Query: 610 GCQTSRRG*DAMA-GPSRCPWQWSQEINLFTTSLSQS 503
           GC   +     M+  P+R P+QW   ++   +S S +
Sbjct: 400 GCGAGKENYQTMSRDPARTPFQWDDSVSAGFSSSSNT 436


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -1

Query: 225 LNLRKDLSASVSACRSARE 169
           LNLR D+S+S S+  S+ E
Sbjct: 365 LNLRTDISSSSSSISSSEE 383


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 198,857
Number of Sequences: 438
Number of extensions: 4344
Number of successful extensions: 11
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).