SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholi...    23   1.6  
EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholi...    23   1.6  
EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholi...    23   1.6  
EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholi...    23   1.6  
EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholi...    23   1.6  
EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholi...    23   1.6  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   4.9  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   4.9  
EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    21   6.5  
AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      21   6.5  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    21   8.6  

>EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 6 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 VLVHHHET-RQYIMETSLNMKIMMLIP-NMHLNTKSKTLTLGT*RANTRLATVM 389
           VL+ HH T  +Y+M + + M  +  +P  + ++   K +T  T     R A  M
Sbjct: 278 VLIFHHRTPDRYVMPSWIKMLFLQWLPCLLRMSRPGKKITKKTILGGNRRAKGM 331


>EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 5 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 VLVHHHET-RQYIMETSLNMKIMMLIP-NMHLNTKSKTLTLGT*RANTRLATVM 389
           VL+ HH T  +Y+M + + M  +  +P  + ++   K +T  T     R A  M
Sbjct: 278 VLIFHHRTPDRYVMPSWIKMLFLQWLPCLLRMSRPGKKITKKTILGGNRRAKGM 331


>EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 4 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 VLVHHHET-RQYIMETSLNMKIMMLIP-NMHLNTKSKTLTLGT*RANTRLATVM 389
           VL+ HH T  +Y+M + + M  +  +P  + ++   K +T  T     R A  M
Sbjct: 278 VLIFHHRTPDRYVMPSWIKMLFLQWLPCLLRMSRPGKKITKKTILGGNRRAKGM 331


>EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 3 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 VLVHHHET-RQYIMETSLNMKIMMLIP-NMHLNTKSKTLTLGT*RANTRLATVM 389
           VL+ HH T  +Y+M + + M  +  +P  + ++   K +T  T     R A  M
Sbjct: 278 VLIFHHRTPDRYVMPSWIKMLFLQWLPCLLRMSRPGKKITKKTILGGNRRAKGM 331


>EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 2 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 VLVHHHET-RQYIMETSLNMKIMMLIP-NMHLNTKSKTLTLGT*RANTRLATVM 389
           VL+ HH T  +Y+M + + M  +  +P  + ++   K +T  T     R A  M
Sbjct: 278 VLIFHHRTPDRYVMPSWIKMLFLQWLPCLLRMSRPGKKITKKTILGGNRRAKGM 331


>EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 1 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 VLVHHHET-RQYIMETSLNMKIMMLIP-NMHLNTKSKTLTLGT*RANTRLATVM 389
           VL+ HH T  +Y+M + + M  +  +P  + ++   K +T  T     R A  M
Sbjct: 278 VLIFHHRTPDRYVMPSWIKMLFLQWLPCLLRMSRPGKKITKKTILGGNRRAKGM 331


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +3

Query: 219 IHAAPVLVHHHETRQ 263
           IH   VLVHH E  +
Sbjct: 664 IHVKEVLVHHREMEE 678


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +3

Query: 219 IHAAPVLVHHHETRQ 263
           IH   VLVHH E  +
Sbjct: 664 IHVKEVLVHHREMEE 678


>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +3

Query: 411 CMKLMDL-SVLWNTPPSKHNGFNAVVQAHCSDKAAEPVQQ 527
           C   +D  S + N   +KH    A V+AH      +P++Q
Sbjct: 574 CRHYLDAKSSVQNYSLAKHQLKEAFVKAHLGSWVKKPIEQ 613


>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 7/24 (29%), Positives = 13/24 (54%)
 Frame = -1

Query: 216 SELHDALLLVQHGRIDLHSHDHES 145
           S+LH  +  + HG +++H     S
Sbjct: 79  SDLHALVEFIYHGEVNVHQRSLSS 102


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 7/20 (35%), Positives = 11/20 (55%)
 Frame = +2

Query: 293 DYDAHPKYAFEYKIEDPHTG 352
           DYD+ P+Y  + +    H G
Sbjct: 366 DYDSRPQYQIDKRSMGSHHG 385


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,993
Number of Sequences: 438
Number of extensions: 3099
Number of successful extensions: 11
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16440594
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).