SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    23   3.9  
AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropi...    23   3.9  
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    22   6.9  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    22   6.9  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    22   6.9  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    22   6.9  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    22   6.9  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    22   6.9  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    22   6.9  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    22   6.9  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    22   6.9  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   9.1  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   9.1  
DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex det...    21   9.1  
DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex det...    21   9.1  
DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex det...    21   9.1  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    21   9.1  

>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +1

Query: 115 SMEVYVESENNVQKCIEI 168
           ++ VY E + NVQ C EI
Sbjct: 642 NLNVYPEFQENVQLCSEI 659


>AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropin
           releasing hormone-binding protein protein.
          Length = 332

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 15/56 (26%), Positives = 23/56 (41%)
 Frame = -2

Query: 691 QFTGETILQ*HGFLFTQVLMSLSYRTNKSGIMFQAFINTISVRRKGNRFLKHVSSP 524
           +F G+ I     F  +Q +  + YR  KSG  F  F   +   R  N     ++ P
Sbjct: 150 EFCGKNIGMKRIFTSSQNIAVIEYRIPKSGKGFSLFARFLKNPRPCNVLATSLTEP 205


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 112 PVPVPFPVYYGNFPPRPMGPF 132


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 112 PVPVPFPVYYGNFPPRPMGPF 132


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 112 PVPVPFPVYYGNFPPRPMGPF 132


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 112 PVPVPFPVYYGNFPPRPMGPF 132


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 345 PVPVPFPVYYGNFPPRPMGPF 365


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 345 PVPVPFPVYYGNFPPRPMGPF 365


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 345 PVPVPFPVYYGNFPPRPMGPF 365


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 345 PVPVPFPVYYGNFPPRPMGPF 365


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/21 (38%), Positives = 10/21 (47%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P    PF
Sbjct: 334 PVPVPFPVYYGNFPPRPMGPF 354


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/21 (33%), Positives = 14/21 (66%)
 Frame = -1

Query: 416 VFFPIFN*YQNIFYYSNIIYK 354
           +FFPI   + N+ Y+S  +++
Sbjct: 421 IFFPIVFAFFNLAYWSTYLFR 441


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/21 (33%), Positives = 14/21 (66%)
 Frame = -1

Query: 416 VFFPIFN*YQNIFYYSNIIYK 354
           +FFPI   + N+ Y+S  +++
Sbjct: 421 IFFPIVFAFFNLAYWSTYLFR 441


>DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P +  P+
Sbjct: 114 PVPVPVPVYYGNFPPRSMGPW 134


>DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P +  P+
Sbjct: 114 PVPVPVPVYYGNFPPRSMGPW 134


>DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P +  P+
Sbjct: 114 PVPVPVPVYYGNFPPRSMGPW 134


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = -1

Query: 710 PAQYGTPIYWGNHSPMTWFPF 648
           P     P+Y+GN  P +  P+
Sbjct: 347 PVPVPVPVYYGNFPPRSMGPW 367


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,840
Number of Sequences: 438
Number of extensions: 4157
Number of successful extensions: 19
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22901220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).