SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY568009-1|AAS73299.1|  300|Apis mellifera ADP/ATP translocase p...   135   4e-34
AY332626-1|AAQ24500.1|  300|Apis mellifera ADP/ATP translocase p...   135   4e-34
EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    23   4.2  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   9.6  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   9.6  

>AY568009-1|AAS73299.1|  300|Apis mellifera ADP/ATP translocase
           protein.
          Length = 300

 Score =  135 bits (327), Expect = 4e-34
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGRAKS+ILYK+T+HCWATI KTEG + FFKGAFSN+LRGTGGA
Sbjct: 228 IVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWATIYKTEGGNAFFKGAFSNILRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VLVLYDEIK +L
Sbjct: 288 LVLVLYDEIKNLL 300



 Score = 30.3 bits (65), Expect = 0.021
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   +  YK  I C+  I K +G   +++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNLANVIR 82



 Score = 27.9 bits (59), Expect = 0.11
 Identities = 12/45 (26%), Positives = 21/45 (46%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           YP D  R R+    G+A  +  +    +C   I K +G +  ++G
Sbjct: 134 YPLDFARTRLAADVGKAGGEREFTGLGNCLTKIFKADGITGLYRG 178


>AY332626-1|AAQ24500.1|  300|Apis mellifera ADP/ATP translocase
           protein.
          Length = 300

 Score =  135 bits (327), Expect = 4e-34
 Identities = 61/73 (83%), Positives = 68/73 (93%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSGRAKS+ILYK+T+HCWATI KTEG + FFKGAFSN+LRGTGGA
Sbjct: 228 IVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWATIYKTEGGNAFFKGAFSNILRGTGGA 287

Query: 181 FVLVLYDEIKKVL 219
            VLVLYDEIK +L
Sbjct: 288 LVLVLYDEIKNLL 300



 Score = 30.3 bits (65), Expect = 0.021
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +   +  YK  I C+  I K +G   +++G  +NV+R
Sbjct: 30  PIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNLANVIR 82



 Score = 27.9 bits (59), Expect = 0.11
 Identities = 12/45 (26%), Positives = 21/45 (46%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           YP D  R R+    G+A  +  +    +C   I K +G +  ++G
Sbjct: 134 YPLDFARTRLAADVGKAGGEREFTGLGNCLTKIFKADGITGLYRG 178


>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 9/24 (37%), Positives = 16/24 (66%)
 Frame = -1

Query: 209 LISSYKTSTKAPPVPLRTLEKAPL 138
           L++++KT T+ P    + LEK P+
Sbjct: 134 LVNAFKTLTQEPKNTNKFLEKGPV 157


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +2

Query: 257 DSVSQPLPSNHVLLDTKTTLVTYF*LNKVLYNDSIIYCFI 376
           D+V+Q   S  + L     L +Y   N  +Y D++I C +
Sbjct: 282 DAVTQIFFSYALGLGALVALGSYNKFNNNVYKDALIVCTV 321


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +2

Query: 257 DSVSQPLPSNHVLLDTKTTLVTYF*LNKVLYNDSIIYCFI 376
           D+V+Q   S  + L     L +Y   N  +Y D++I C +
Sbjct: 335 DAVTQIFFSYALGLGALVALGSYNKFNNNVYKDALIVCTV 374


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,874
Number of Sequences: 438
Number of extensions: 3849
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24154023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).