SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    26   0.31 
AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective...    24   1.3  

>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 26.2 bits (55), Expect = 0.31
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = -1

Query: 713 GGPVLWNEPRLKPAV 669
           GGPVLW  PR K  V
Sbjct: 350 GGPVLWQNPRTKRLV 364


>AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective
           protein-1 protein.
          Length = 128

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 11/31 (35%), Positives = 13/31 (41%)
 Frame = +3

Query: 138 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLP 230
           A   +C    C  CS  +  CS    P CLP
Sbjct: 80  AEGMQCSCNKCIGCSAEKFECSKTSNP-CLP 109


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,603
Number of Sequences: 438
Number of extensions: 2852
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22292145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).