SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    23   2.6  
DQ091184-1|AAZ42364.1|  157|Apis mellifera lipophorin receptor p...    22   4.5  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    22   6.0  
DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    21   7.9  

>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = +1

Query: 523 KRITKDAGEKV-SKATNTISLPSSKFLWIQFRDLRNYNQKI 642
           K  ++D  E+  SK    IS  S+ + +  + +  NYN+K+
Sbjct: 64  KERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNYNKKL 104


>DQ091184-1|AAZ42364.1|  157|Apis mellifera lipophorin receptor
           protein.
          Length = 157

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/25 (32%), Positives = 17/25 (68%)
 Frame = -3

Query: 148 LKKLPEILICSQRTTTTLFPSRRTL 74
           LK L + L+C ++ +TT+ P+ + +
Sbjct: 68  LKLLSDGLMCVEKVSTTIVPTTQEI 92


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -3

Query: 562 PSTLSHQHPW 533
           P+  SH+HPW
Sbjct: 122 PNHSSHEHPW 131


>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 503 SAMKRNLRGSPRMLVRKCRRRQT 571
           S M+ NLRG  +   R+  +RQ+
Sbjct: 382 SRMENNLRGETQSNYREMEKRQS 404


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,521
Number of Sequences: 438
Number of extensions: 4203
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).