SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X72575-1|CAA51167.1|  168|Apis mellifera Apidaecin precursor pro...    24   1.2  
X72577-1|CAA51169.1|  283|Apis mellifera Apidaecin precursor pro...    24   1.6  
AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        23   2.8  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   6.5  
EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    21   8.6  
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    21   8.6  

>X72575-1|CAA51167.1|  168|Apis mellifera Apidaecin precursor
           protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSH 569
           V++P P P   RL R P   P     + ++I  P   H
Sbjct: 104 VYIPQPRPPHPRLRREPEAEPGNN--RPVYIPQPRPPH 139



 Score = 24.2 bits (50), Expect = 1.2
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSH 569
           V++P P P   RL R P   P     + ++I  P   H
Sbjct: 130 VYIPQPRPPHPRLRREPEAEPGNN--RPVYIPQPRPPH 165


>X72577-1|CAA51169.1|  283|Apis mellifera Apidaecin precursor
           protein.
          Length = 283

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 12/56 (21%), Positives = 22/56 (39%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDTP 623
           V++P P P   RL R   +     + + ++I  P   H      + P  +   + P
Sbjct: 75  VYIPQPRPPHPRLRREAELEAEPGNNRPVYISQPRPPHPRLRREAEPEAEPGNNRP 130



 Score = 23.8 bits (49), Expect = 1.6
 Identities = 12/56 (21%), Positives = 22/56 (39%)
 Frame = +3

Query: 456 VHVPPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDTP 623
           V++P P P   RL R   +     + + ++I  P   H      + P  +   + P
Sbjct: 131 VYIPQPRPPHPRLRREAELEAEPGNNRPVYISQPRPPHPRLRREAEPEAEPGNNRP 186


>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = -3

Query: 395 SSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 279
           ++ +S A  AAAA   +T   +S R  ++  GN A   A
Sbjct: 125 TAASSAALAAAAAVDAATAGDKSCRYTASLAGNVAPASA 163


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = -3

Query: 545  EDDLVMFLGWSHTRDTRKSLLNWFW 471
            E + V+ L WS +    K  L  FW
Sbjct: 1204 ESETVLTLAWSESNVESKGRLLGFW 1228


>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = -2

Query: 330 VHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAADRGRAE 211
           V Q   R Q    +  GH    +  H NSS S+   G+ +
Sbjct: 789 VQQSQQRHQHAAQMIYGHQQSHHGLHINSSPSSVQSGQQQ 828


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +3

Query: 432 PLVQKHIYVH 461
           PL+QKH+ +H
Sbjct: 317 PLIQKHLKIH 326


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,671
Number of Sequences: 438
Number of extensions: 2822
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21683070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).