SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    23   2.4  
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      22   5.4  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   5.4  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    21   9.5  

>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%)
 Frame = +2

Query: 206 DSTIEPQILH*KNSMSMGRNCRCSCNERPKNQ-----EIKRIWIYYIFS 337
           DS IEP+I   +NS+S G +      E P ++        R + YY++S
Sbjct: 293 DSPIEPEIEISQNSVSTGSDKENHKTEEPNDEVATYDNTPRDFPYYMYS 341


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = -3

Query: 614 HNHQTLQNQSPFSFLFLYLSQH*QKQY 534
           H+HQ L  QSP+    +Y +   +K+Y
Sbjct: 77  HHHQVLYQQSPY---LMYENPDEEKRY 100


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -2

Query: 582 LFFPVSLSVTTLTETIFPNV 523
           +F PVS   TT+   I+P V
Sbjct: 829 MFLPVSYMSTTMAGVIYPPV 848


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 6/15 (40%), Positives = 11/15 (73%)
 Frame = -1

Query: 727 NHYPRPDMSVFGYWL 683
           NH   P+++V+G W+
Sbjct: 579 NHSCDPNLAVYGVWI 593


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 194,802
Number of Sequences: 438
Number of extensions: 3675
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23911269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).