SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U66709-1|AAB07515.1|  182|Apis mellifera ankyrin protein.              25   0.53 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    23   1.6  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    22   2.8  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    22   3.7  
DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    21   4.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   4.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   4.9  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   4.9  
AB006152-1|BAA24504.1|  178|Apis mellifera inositol 1,4,5-tripho...    21   4.9  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   6.5  
AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    21   8.6  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          21   8.6  

>U66709-1|AAB07515.1|  182|Apis mellifera ankyrin protein.
          Length = 182

 Score = 24.6 bits (51), Expect = 0.53
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +2

Query: 236 FIVVSARIDIIRCTFSYLVVLDVNTSLYFIEK 331
           FI+ S R+D++  T   L + D    ++ +E+
Sbjct: 149 FIIYSKRMDVLEATLRVLCMTDGKEGMHTLER 180


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 23.0 bits (47), Expect = 1.6
 Identities = 8/24 (33%), Positives = 14/24 (58%)
 Frame = -3

Query: 427 LAHHPRTRRHAHNTTPVGALPSTQ 356
           +  H +++ H H T+P    PS+Q
Sbjct: 663 IVQHTQSQLHLHLTSPPARSPSSQ 686


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 22.2 bits (45), Expect = 2.8
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = +3

Query: 48  LSVLADFLGAIGSGHW 95
           ++   D  G IG+GHW
Sbjct: 105 IAYTGDVHGVIGAGHW 120


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 21.8 bits (44), Expect = 3.7
 Identities = 10/26 (38%), Positives = 12/26 (46%)
 Frame = +2

Query: 26  RRTVHRGSVSAGRLPRGHRLRALGYC 103
           RR    GS      PR HR ++L  C
Sbjct: 55  RRNPGPGSKGPRDFPRSHRFKSLPRC 80


>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 141 KDLEVLVNDGDGEQYPSARS 82
           K +++LV+D D E Y   +S
Sbjct: 165 KQVQLLVSDSDVESYKQIKS 184


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -3

Query: 256 SSRNDNKNGAERSGPTAAII 197
           S+RN   + A RSG  A I+
Sbjct: 590 SARNKQGHSARRSGDVAVIV 609


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -3

Query: 256 SSRNDNKNGAERSGPTAAII 197
           S+RN   + A RSG  A I+
Sbjct: 590 SARNKQGHSARRSGDVAVIV 609


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = +3

Query: 96  DTARRHHHLPVLRDLCQGTSGDGRH 170
           +T +RHHHL       Q T+    H
Sbjct: 136 ETLQRHHHLQNHHHHLQSTAVQDHH 160


>AB006152-1|BAA24504.1|  178|Apis mellifera inositol
           1,4,5-triphosphate recepter protein.
          Length = 178

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 141 KDLEVLVNDGDGEQYPSARS 82
           K +++LV+D D E Y   +S
Sbjct: 133 KQVQLLVSDSDVESYKQIKS 152


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 13/52 (25%), Positives = 23/52 (44%)
 Frame = -1

Query: 288 RYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLRLFLDKDL 133
           +Y  V   M    ET I  ++     LP+S +  + +  H     L +D+D+
Sbjct: 74  QYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLIVDRDV 125


>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -3

Query: 364 STQQILNLKSNFFDKVQRCIH 302
           STQ I ++KS +      CIH
Sbjct: 318 STQYIRHIKSPYHTPEPDCIH 338


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = -3

Query: 268 NDVDSSRNDNKNGAERSG 215
           N+ +++ N+N NGA  +G
Sbjct: 241 NNNNNNNNNNNNGANDNG 258


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,910
Number of Sequences: 438
Number of extensions: 2759
Number of successful extensions: 12
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12436029
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).