SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    25   1.1  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    22   7.5  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    22   7.5  

>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = -1

Query: 583 VVSGVLNLAH*TVSFNQSVLAVHSVPSRDSCW 488
           ++ G+L LA   +  N  +L  HS+ SR   W
Sbjct: 244 LMDGILGLALGPIRNNDRILYFHSLASRVESW 275


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +3

Query: 492 HESRDGTLCTASTLWLKLTVQC 557
           HE++  TLC A +L   +T+ C
Sbjct: 733 HETQITTLCVAISLSATVTLVC 754


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +3

Query: 492 HESRDGTLCTASTLWLKLTVQC 557
           HE++  TLC A +L   +T+ C
Sbjct: 823 HETQITTLCVAISLSATVTLVC 844


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 140,572
Number of Sequences: 438
Number of extensions: 2135
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25125039
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).