SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      24   2.0  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    22   6.1  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    22   6.1  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   6.1  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    22   6.1  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   8.0  

>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +1

Query: 757 KVNKRKNHFQSANSTLCSM 813
           K +K + HFQ  NS +C++
Sbjct: 388 KRHKEQQHFQPLNSAVCAL 406


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -3

Query: 495 WSENILEDLDYADDIVLMTPTLDQMQAKLEDLR 397
           WS   +EDL  +D+  +  PT+ ++Q  L  L+
Sbjct: 93  WSTLPIEDLTKSDNEDITYPTVLEVQLNLPILK 125


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -3

Query: 495 WSENILEDLDYADDIVLMTPTLDQMQAKLEDLR 397
           WS   +EDL  +D+  +  PT+ ++Q  L  L+
Sbjct: 131 WSTLPIEDLTKSDNEDITYPTVLEVQLNLPILK 163


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +3

Query: 591  RCHLNRGSQDLVMHDSTCTT 650
            R H   G  +   HD+TCTT
Sbjct: 1073 RQHTAEGVPEQPPHDTTCTT 1092


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = +1

Query: 343 HVDSFVGVNTQASF-LRRYTEVFKFCLHLIQSWRHQHYVICIVKVFQDIF 489
           H++  +G   +    LR Y    ++ +  + + RH+ Y  C  + + DIF
Sbjct: 177 HINQNMGDKVEIGIDLREYYPSVEWDILGVPAERHKKYYPCCDEPYPDIF 226


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +2

Query: 743 KRFSQKSTNVRIIFSLPIRHFVL 811
           K FS+ ST+ RI+ S  ++HF +
Sbjct: 247 KFFSRSSTS-RIVISESLKHFTI 268


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 238,230
Number of Sequences: 438
Number of extensions: 5266
Number of successful extensions: 11
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26702940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).