SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    25   0.63 
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    25   0.83 
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    25   0.83 
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          24   1.1  
AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    22   4.4  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   5.9  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   5.9  

>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 25.0 bits (52), Expect = 0.63
 Identities = 16/74 (21%), Positives = 28/74 (37%)
 Frame = -3

Query: 544 LLPENELAENPATIAAFCFFSNYIQYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDLP 365
           L P++ +  NP             Q+     SP+   S+ P  P  ++  DE+ +   L 
Sbjct: 103 LQPQHVVYGNPQQQQLAAETQQQQQHNNGYASPMSTSSYDPYSPNSKIGRDELSQPGSLN 162

Query: 364 KRPGTDGVHGSRLK 323
               +DG    + K
Sbjct: 163 GYGSSDGCDARKKK 176


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 24.6 bits (51), Expect = 0.83
 Identities = 10/37 (27%), Positives = 17/37 (45%)
 Frame = -2

Query: 392 RSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 282
           ++CP   +   A+ G  P     GP ++L G    L+
Sbjct: 262 QACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVLALE 298


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 24.6 bits (51), Expect = 0.83
 Identities = 10/37 (27%), Positives = 17/37 (45%)
 Frame = -2

Query: 392 RSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 282
           ++CP   +   A+ G  P     GP ++L G    L+
Sbjct: 262 QACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVLALE 298


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -3

Query: 367 PKRPGTDGVHGSRLKVHH 314
           P+ PGT  ++ ++LK HH
Sbjct: 139 PREPGTPRINFTKLKRHH 156


>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 5/16 (31%), Positives = 12/16 (75%)
 Frame = +2

Query: 458 VDSVLDVVRKEAEGCD 505
           +DS+++++R   + CD
Sbjct: 106 IDSIINIIRVRVDACD 121


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 46  FFLHDQILESVYL 84
           FFLH Q+L   YL
Sbjct: 259 FFLHKQVLNRYYL 271


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 46  FFLHDQILESVYL 84
           FFLH Q+L   YL
Sbjct: 259 FFLHKQVLNRYYL 271


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,398
Number of Sequences: 438
Number of extensions: 4473
Number of successful extensions: 8
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).