SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0035
         (648 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   2.5  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    23   2.5  
AY343324-1|AAQ21381.1|  156|Apis mellifera vacuolar H+ ATP synth...    22   4.4  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    21   7.8  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    21   7.8  

>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 538 QQRSSGWQRY*QPSVYRLPRAADAGQPP 621
           QQ SSG     QPS ++ P+A   G PP
Sbjct: 14  QQPSSGAPGP-QPSPHQSPQAPQRGSPP 40


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = +2

Query: 518 ASPGIFNSRGAADGSDISSRRFIDYPAPQMQD 613
           + PG  N  G++DG D   ++    P P+ Q+
Sbjct: 156 SQPGSLNGYGSSDGCDARKKK---GPTPRQQE 184


>AY343324-1|AAQ21381.1|  156|Apis mellifera vacuolar H+ ATP synthase
           16 kDa proteolipidsubunit protein.
          Length = 156

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +2

Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAADGS 562
           +E HP     +   G AS  IF++ GAA G+
Sbjct: 3   DEDHPIYAPFFGVMGAASAIIFSALGAAYGT 33


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +3

Query: 414 FPDKPWKGQQNEPN 455
           F D+P  G+ N+PN
Sbjct: 234 FLDEPLSGETNDPN 247


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +3

Query: 414 FPDKPWKGQQNEPN 455
           F D+P  G+ N+PN
Sbjct: 234 FLDEPLSGETNDPN 247


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,249
Number of Sequences: 438
Number of extensions: 4656
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).