SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    25   0.52 
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    25   0.91 
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   2.8  
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    22   6.4  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   6.4  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 25.4 bits (53), Expect = 0.52
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -1

Query: 194 FWRRTFAASARVQLKLDTVELLATSAAQSQ 105
           FW +  AA ARV L + ++  L+T  A+SQ
Sbjct: 266 FWIKPEAAPARVTLGVTSLLTLSTQHAKSQ 295


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 24.6 bits (51), Expect = 0.91
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = -1

Query: 194 FWRRTFAASARVQLKLDTVELLATSAAQSQ 105
           FW +  A  ARV L + ++  LAT   QSQ
Sbjct: 235 FWIKPEAIPARVTLGVTSLLTLATQNTQSQ 264


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 7/30 (23%), Positives = 15/30 (50%)
 Frame = -1

Query: 497 VYQCKKAFRLNIATNCSDTLLNMVCMAVVL 408
           +Y CK+   +  AT+C    ++  C   ++
Sbjct: 171 LYNCKRTATITAATDCQLWAIDRQCFQTIM 200


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = -1

Query: 194 FWRRTFAASARVQLKLDTVELLAT 123
           FW    A SARV L + TV  + T
Sbjct: 263 FWINHEATSARVALGITTVLTMTT 286


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -3

Query: 240 TVKYLPCRGSHATIMFLASNICSVSSGT 157
           T KY+     +A  + LAS I S S+GT
Sbjct: 2   TAKYVFTTLINAAFLCLASTILSESAGT 29


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,253
Number of Sequences: 438
Number of extensions: 3763
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).