SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    25   0.47 
AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.         23   1.9  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    21   5.8  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 24.6 bits (51), Expect = 0.47
 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +3

Query: 192 RQSGPGDRGPR-FS*SHRKMIFKRTP 266
           R  GPG +GPR F  SHR   FK  P
Sbjct: 56  RNPGPGSKGPRDFPRSHR---FKSLP 78


>AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.
          Length = 104

 Score = 22.6 bits (46), Expect = 1.9
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -3

Query: 142 STWAREQHWSCSKPAPERRRRIGSLRNSL 56
           S W    H +C+     +RR+ GS RN +
Sbjct: 71  SKWLSINHSACAIRCLAQRRKGGSCRNGV 99


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 21.0 bits (42), Expect = 5.8
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%)
 Frame = -2

Query: 230 AEPRTSIAGPALTMPSR---MFLPIFSIFLKIFHL 135
           AE R S    +   P R   +FL + S+F++IF+L
Sbjct: 248 AEGRLSSDNMSKKSPVRKATLFLNMASVFMRIFNL 282


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,320
Number of Sequences: 438
Number of extensions: 2194
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 11121030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).