SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    24   0.32 
DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid p...    22   1.3  
AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatas...    22   1.3  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    22   1.3  
AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    22   1.7  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   2.3  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   2.3  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   4.0  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    21   4.0  
AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      20   5.3  
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    20   5.3  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              20   7.0  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    20   7.0  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        20   7.0  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        20   7.0  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        20   7.0  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    20   7.0  
AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    19   9.2  

>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 24.2 bits (50), Expect = 0.32
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = -2

Query: 108 FLTILRREAP*RVPYLPVIP 49
           FL ++    P  VPY PVIP
Sbjct: 639 FLVVISSSNPLNVPYGPVIP 658


>DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid
           phosphatase protein.
          Length = 373

 Score = 22.2 bits (45), Expect = 1.3
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = +1

Query: 28  GQTYQKGWNYWQIWHTL 78
           G+     W+Y+ I+HTL
Sbjct: 165 GKNITTPWDYYYIYHTL 181


>AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatase
           precursor protein.
          Length = 388

 Score = 22.2 bits (45), Expect = 1.3
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = +1

Query: 28  GQTYQKGWNYWQIWHTL 78
           G+     W+Y+ I+HTL
Sbjct: 180 GKNITTPWDYYYIYHTL 196


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 22.2 bits (45), Expect = 1.3
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = +1

Query: 28  GQTYQKGWNYWQIWHTL 78
           G+     W+Y+ I+HTL
Sbjct: 68  GKNITTPWDYYYIYHTL 84


>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 21.8 bits (44), Expect = 1.7
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = -1

Query: 202 SLTRPDADTRTFHSILTTK*ASILCVL 122
           + TRP   T TFH IL  K A+ L VL
Sbjct: 334 TFTRPCGITLTFHEIL--KRANTLFVL 358


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.4 bits (43), Expect = 2.3
 Identities = 10/30 (33%), Positives = 12/30 (40%)
 Frame = +2

Query: 68  GTRYGASLRKMVKKMEVTQHAKYTCSFCGK 157
           G  +  S +  V     T    YTC  CGK
Sbjct: 210 GKGFTCSKQLKVHTRTHTGEKPYTCDICGK 239


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.4 bits (43), Expect = 2.3
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 75  RVPYLPVIPTFLV 37
           R+P LP+IP + V
Sbjct: 784 RIPILPMIPVYCV 796


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 20.6 bits (41), Expect = 4.0
 Identities = 7/25 (28%), Positives = 13/25 (52%)
 Frame = +3

Query: 15  GLPKWPNVPKRLELLANMAHVTVPL 89
           G+P  PN+P  +  +  M  +  P+
Sbjct: 428 GMPPLPNMPGSMPTMPTMPSMAGPI 452


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 20.6 bits (41), Expect = 4.0
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 103 DHFT*RGTVTCAIFASNSNLFGTFGHFGK 17
           D+F     V  A+FA  S+ +  F  FG+
Sbjct: 596 DNFGPLSNVRFAVFALGSSAYPNFCAFGR 624


>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 20.2 bits (40), Expect = 5.3
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +2

Query: 134 YTCSFCGK 157
           YTC  CGK
Sbjct: 372 YTCDVCGK 379


>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 20.2 bits (40), Expect = 5.3
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -3

Query: 188 RCRHKNVS*HPYHK 147
           +CR+ N S  PY+K
Sbjct: 435 QCRYPNASVTPYNK 448


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 19.8 bits (39), Expect = 7.0
 Identities = 7/28 (25%), Positives = 15/28 (53%)
 Frame = -2

Query: 189  QMPTQERFIASLPQNEQVYFACWVTSIF 106
            Q+P    FI  + + +   ++C+V + F
Sbjct: 1325 QLPEGSLFIKEVDRTDAGEYSCYVENTF 1352


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 19.8 bits (39), Expect = 7.0
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +2

Query: 125 HAKYTCSFCG 154
           H +YTC  CG
Sbjct: 480 HDEYTCMDCG 489


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 19.8 bits (39), Expect = 7.0
 Identities = 5/9 (55%), Positives = 5/9 (55%)
 Frame = +1

Query: 43  KGWNYWQIW 69
           K WN W  W
Sbjct: 694 KSWNKWNDW 702


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 19.8 bits (39), Expect = 7.0
 Identities = 5/9 (55%), Positives = 5/9 (55%)
 Frame = +1

Query: 43  KGWNYWQIW 69
           K WN W  W
Sbjct: 694 KSWNKWNDW 702


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 19.8 bits (39), Expect = 7.0
 Identities = 5/9 (55%), Positives = 5/9 (55%)
 Frame = +1

Query: 43  KGWNYWQIW 69
           K WN W  W
Sbjct: 694 KSWNKWNDW 702


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 19.8 bits (39), Expect = 7.0
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +2

Query: 230 WVFSTTAAYHADLLSGG 280
           W + TT   HA L +GG
Sbjct: 124 WKYYTTNESHACLSTGG 140


>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 19.4 bits (38), Expect = 9.2
 Identities = 10/44 (22%), Positives = 21/44 (47%)
 Frame = -2

Query: 240 ENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTSI 109
           E+    P +  + + QDQ      F+A   ++ +  F  WV+++
Sbjct: 417 EHRPFEPKSTAVQKYQDQDYQPIYFVADSFEDAKEKFRRWVSTM 460


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,345
Number of Sequences: 438
Number of extensions: 2188
Number of successful extensions: 18
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  5744526
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).