SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0022
         (598 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    24   1.3  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   2.3  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    22   5.3  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   5.3  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   5.3  
AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    21   6.9  

>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = +3

Query: 351 QENISLQYFYHDL-FEI*FVYGIKLIIICTV 440
           ++N+ +   Y D  + I F Y I LI++CTV
Sbjct: 802 EDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 7/27 (25%), Positives = 17/27 (62%)
 Frame = +2

Query: 8   VFKNFKMKTLIFIMLVACVASQAYGAL 88
           +FK FK +  +++++ AC+  + +  L
Sbjct: 431 LFKTFKDRKYLYMLMEACLGGELWTVL 457


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -1

Query: 157 WXXGQQVVGCMXWIFFTVVCTT 92
           W  G +   C  WI F V+C+T
Sbjct: 91  WVFGPRF--CDTWIAFDVMCST 110


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = +3

Query: 93  VVQTTVKKIHXIQPTTCCPXNH*GXGPRXGGXXCLVVP 206
           +V T+V+K       TC   N  G   R  G   ++VP
Sbjct: 573 LVITSVQKKGDAGVYTCSARNKQGHSARRSGDVAVIVP 610


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = +3

Query: 93  VVQTTVKKIHXIQPTTCCPXNH*GXGPRXGGXXCLVVP 206
           +V T+V+K       TC   N  G   R  G   ++VP
Sbjct: 573 LVITSVQKKGDAGVYTCSARNKQGHSARRSGDVAVIVP 610


>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +2

Query: 284 VCKEPLKCIKRVCTKL 331
           + K PL+C+ R CT +
Sbjct: 106 ITKAPLECMCRPCTSV 121


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,723
Number of Sequences: 438
Number of extensions: 3272
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).