SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    25   0.75 
AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    23   2.3  
S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    21   9.2  

>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 24.6 bits (51), Expect = 0.75
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +3

Query: 312 NYVEKNKYDNIVVLDHSFA 368
           NY E+NK D IV+L  +++
Sbjct: 284 NYAEENKRDEIVLLTEAYS 302


>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
           opsin protein.
          Length = 371

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -3

Query: 539 YL*YVNKPFVIIVILLTFS*CCFHIVIKHYY 447
           YL   N+  + +  + TFS C   I+I +YY
Sbjct: 201 YLTDTNEIRIFVATIFTFSYCIPMILIIYYY 231


>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 142 FFIAVILVIQYF 107
           FF++VIL+  YF
Sbjct: 10  FFLSVILITSYF 21


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,856
Number of Sequences: 438
Number of extensions: 3158
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).