SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    27   0.16 
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    26   0.29 
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    26   0.38 
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    24   1.2  
DQ288392-1|ABC41342.1|  120|Apis mellifera nanos protein.              23   2.7  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    23   3.5  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    23   3.5  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    23   3.5  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    22   6.2  
AF393494-1|AAL60419.1|  144|Apis mellifera odorant binding prote...    22   6.2  
AF166496-1|AAD51944.1|  144|Apis mellifera pheromone-binding pro...    22   6.2  
DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    21   8.2  
AB006152-1|BAA24504.1|  178|Apis mellifera inositol 1,4,5-tripho...    21   8.2  

>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 27.1 bits (57), Expect = 0.16
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +3

Query: 573 NELLFKSNNVDYSYFSYNXEVYY 641
           N   + +NN  Y+Y +YN ++YY
Sbjct: 320 NNYNYNNNNYKYNYNNYNKKLYY 342


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 26.2 bits (55), Expect = 0.29
 Identities = 7/18 (38%), Positives = 14/18 (77%)
 Frame = -3

Query: 424 FSNYFWRNGNWKRCFYNV 371
           +SN ++ N N+K+ +YN+
Sbjct: 313 YSNNYYNNNNYKKLYYNI 330


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 25.8 bits (54), Expect = 0.38
 Identities = 10/42 (23%), Positives = 23/42 (54%)
 Frame = +2

Query: 338 IKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRK 463
           +    K++ + +  +A  P+  P  + +++SP + K  TP+K
Sbjct: 752 VAKNKKNVGSMSRNKALLPVIKPANVNKEQSPNSTKETTPKK 793


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 9/17 (52%), Positives = 10/17 (58%)
 Frame = -1

Query: 645 SNNTPXRYKKNTNNQHY 595
           S+N P    KN NN HY
Sbjct: 107 SSNDPKNQYKNQNNNHY 123


>DQ288392-1|ABC41342.1|  120|Apis mellifera nanos protein.
          Length = 120

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +2

Query: 299 SVPKRKKNIQPLP 337
           + P+RKKN +PLP
Sbjct: 25  TTPRRKKNKKPLP 37


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +3

Query: 573 NELLFKSNNVDYSYFSYNXEVYY 641
           N   +  NN +Y+  +YN ++YY
Sbjct: 92  NNYKYNYNNNNYNNNNYNKKLYY 114


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +3

Query: 573 NELLFKSNNVDYSYFSYNXEVYY 641
           N   +  NN +Y+  +YN ++YY
Sbjct: 92  NNYKYNYNNNNYNNNNYNKKLYY 114


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +1

Query: 211 SVLKASSTIGGYLSSVCISTVRRNKK 288
           SVL    T+G   S +C S   +NKK
Sbjct: 529 SVLTELRTLGNQNSEMCFSLKFKNKK 554


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 7/16 (43%), Positives = 12/16 (75%)
 Frame = +3

Query: 594 NNVDYSYFSYNXEVYY 641
           NN + +Y +YN ++YY
Sbjct: 95  NNYNNNYNNYNKKLYY 110


>AF393494-1|AAL60419.1|  144|Apis mellifera odorant binding protein
           ASP1 protein.
          Length = 144

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -3

Query: 163 KVLPWSFTSSCNLSSFFSKCLKE 95
           K LP S + +CN     +KC++E
Sbjct: 113 KCLPTSGSDNCNKIYNLAKCVQE 135


>AF166496-1|AAD51944.1|  144|Apis mellifera pheromone-binding
           protein ASP1 protein.
          Length = 144

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -3

Query: 163 KVLPWSFTSSCNLSSFFSKCLKE 95
           K LP S + +CN     +KC++E
Sbjct: 113 KCLPTSGSDNCNKIYNLAKCVQE 135


>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIV 231
           FLR +L   +  YPP+V
Sbjct: 127 FLRVLLHLAMHDYPPLV 143


>AB006152-1|BAA24504.1|  178|Apis mellifera inositol
           1,4,5-triphosphate recepter protein.
          Length = 178

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIV 231
           FLR +L   +  YPP+V
Sbjct: 95  FLRVLLHLAMHDYPPLV 111


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,573
Number of Sequences: 438
Number of extensions: 3745
Number of successful extensions: 17
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20586735
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).