SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    23   3.0  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              21   6.9  
L01588-1|AAA27735.1|   74|Apis mellifera zinc finger protein pro...    21   9.2  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    21   9.2  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   9.2  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
            protein.
          Length = 1308

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +1

Query: 394  IKVKPKNSSVNSTQTVVAQSVLMNSLLKSVLPCRN 498
            +KV+ +  S  S Q    Q+++ N   KS+L   N
Sbjct: 970  VKVQSQQQSQQSQQQQQQQTIVTNQAGKSILQTAN 1004



 Score = 22.2 bits (45), Expect = 4.0
 Identities = 11/46 (23%), Positives = 22/46 (47%)
 Frame = +1

Query: 166 PMSAGSVQEEELMQKSARAMTQATDPLEKLACFACPEVLQGSWDLE 303
           P+ +  +   E+ Q S + ++ AT    K +    PE+ +   D+E
Sbjct: 255 PIKSEPIDAYEMHQISKKKLSPATPKGSKCSMITTPEIKKEVEDME 300


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 2/56 (3%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGLE--LNKSEAEELFSQFDTDSSGSISLDEF 467
           +F   D + +  L +EE     +   LE          + S  DTD  G ++++EF
Sbjct: 241 MFSHYDRNNNGNLEREELEQFAENEDLEELCRGCNLGHMISYDDTDGDGKLNVNEF 296


>L01588-1|AAA27735.1|   74|Apis mellifera zinc finger protein
           protein.
          Length = 74

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = -2

Query: 333 FHHHPCDGKFFQVPRSLKHL 274
           +H   CD +F QV    +HL
Sbjct: 38  YHCSHCDRQFVQVANLRRHL 57


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 242 LWRNSLALLVPR 277
           +WRN L + VPR
Sbjct: 74  IWRNKLFVTVPR 85


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/29 (27%), Positives = 17/29 (58%)
 Frame = -1

Query: 535 KLLECLFYNLRRDSDMGGRILIRNSSRLI 449
           +L +C+   + RD+   GR+  R  +R++
Sbjct: 124 RLKKCIAVGMSRDAVRFGRVPKREKARIL 152


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,118
Number of Sequences: 438
Number of extensions: 2669
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).