BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0255.Seq (505 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.4 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 5.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 7.3 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 9.6 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 21 9.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.6 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 237 SGTRMRFYFTEIYIRWHRSSLAQIPVVWRPP 329 S +RF +T+ ++W + I V+ PP Sbjct: 75 SNVWLRFIWTDYQLQWDEADYGGIGVLRLPP 105 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 357 SQSVSIALSLSFSLHFDTSVAYLRDVTSVKMLPSCA*RSL 476 S ++ L+ + +HF S + K+LP+CA + L Sbjct: 232 SSELATRLAEAVRIHFTASRDAFYGLPLWKLLPTCAYKQL 271 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = -2 Query: 309 ESARATSGANEYKFQ*NKNACAYRCNVKCER 217 E R ++ K N +Y+ N+KC++ Sbjct: 122 EQKRRKKSLDDVKILRNDRIDSYKSNLKCDK 152 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 51 ESLGDCQALTHHCTAL 4 + + CQA+ HC+ L Sbjct: 31 DGMNQCQAVNGHCSHL 46 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 51 ESLGDCQALTHHCTAL 4 + + CQA+ HC+ L Sbjct: 31 DGMNQCQAVNGHCSHL 46 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 43 ERFYTIFRGAESFYSTKLE 99 + F R E++YS KLE Sbjct: 540 DSFQAALRSIENYYSGKLE 558 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 43 ERFYTIFRGAESFYSTKLE 99 + F R E++YS KLE Sbjct: 578 DSFQAALRSIENYYSGKLE 596 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 153 VWRRTLHSRLVHFS 194 VW+ TL++RLV S Sbjct: 907 VWQVTLNARLVELS 920 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,151 Number of Sequences: 438 Number of extensions: 2418 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -