BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0253.Seq (889 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 25 1.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 1.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 6.5 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 24.6 bits (51), Expect = 1.2 Identities = 18/58 (31%), Positives = 23/58 (39%) Frame = -2 Query: 414 SLLQGFLECHIAAHCFRRQSFNLVSFPAELGQFIDAFILYDGRVYIEANAVRCLNNSW 241 SLL L C + HC R SF A ++A G ++ AVR N W Sbjct: 8 SLLITCLICSPSVHCGTRPSFVSDEMIATAASVVNACQTQTGVATVDIEAVR--NGQW 63 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 3 CSSXFPQSGSFIITLVTFTKDK*Y 74 CS F QSG +I + T T +K Y Sbjct: 181 CSKTFIQSGQLVIHMRTHTGEKPY 204 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 6.5 Identities = 21/67 (31%), Positives = 31/67 (46%) Frame = -3 Query: 380 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAV*TTPGQSVGATSR*STPV 201 P IASA S TSS P A+++ S T+KQ + +T +R + + Sbjct: 515 PRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQELKRLKSTVSLLPLPLARTPSVM 574 Query: 200 RASSTSR 180 ASST + Sbjct: 575 SASSTCK 581 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 521 RSHRISSFGRIQESNRTGR 577 RSHR S R Q SN+ R Sbjct: 70 RSHRFKSLPRCQLSNKRDR 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,776 Number of Sequences: 438 Number of extensions: 4497 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -