BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 24 2.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 5.1 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 6.7 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 22 6.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.7 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 23.8 bits (49), Expect = 2.2 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +2 Query: 359 LLGFVSIMEGRFLAAMFVAPKAVR 430 +LGFVS+M + +F++ K++R Sbjct: 27 MLGFVSVMGNGMVVYIFLSTKSLR 50 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 5.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 657 MPAPYYPHSHSPA 695 +P Y+PH H P+ Sbjct: 312 LPPSYHPHQHHPS 324 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 6.7 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 359 LLGFVSIMEGRFLAAMFVAPKAVR 430 +LGFVS M + +F++ K++R Sbjct: 61 MLGFVSAMGNGMVVYIFLSTKSLR 84 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 480 VGMALLHILHQRLTNTALTAFGATN 406 V A H HQ+ A AFGAT+ Sbjct: 92 VSAAAAHHHHQQQQAVAAAAFGATS 116 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 6.7 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +1 Query: 169 YPGNKP*FGKRNVQNSPRSSNCGWKVQPGASLYKSELLA*LHSAGAGCLSC 321 + N+P K + + P S K +PG+ + SE + S G SC Sbjct: 871 HENNQPTMNKCSDRKRPASQATSVKAEPGSIMAMSESSKKVLSPGELLSSC 921 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 280,704 Number of Sequences: 438 Number of extensions: 7033 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29388177 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -