BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0231.Seq (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 25 0.67 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 25 0.67 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 25 0.67 AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced prot... 24 1.2 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.2 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 23 3.6 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 23 3.6 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 8.3 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 21 8.3 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 8.3 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 8.3 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 21 8.3 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 21 8.3 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +2 Query: 290 VSAILIISELNSLHGASWVSVSRE-DTNKATFCGRXVVGTWVKRRRGPKHLQEKLLRRCV 466 ++ + + LN+LH + + E + F +VGTW + L+E C Sbjct: 161 ITKLTAMGVLNNLHDPEYSARENELRALSSLFSKGCLVGTWSPDPAINRRLKETYSNMCA 220 Query: 467 LYSSIQIC 490 L ++C Sbjct: 221 LCEKPEVC 228 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +2 Query: 290 VSAILIISELNSLHGASWVSVSRE-DTNKATFCGRXVVGTWVKRRRGPKHLQEKLLRRCV 466 ++ + + LN+LH + + E + F +VGTW + L+E C Sbjct: 161 ITKLTAMGVLNNLHDPEYSARENELRALSSLFSKGCLVGTWSPDPAINRRLKETYSNMCA 220 Query: 467 LYSSIQIC 490 L ++C Sbjct: 221 LCEKPEVC 228 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.67 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +2 Query: 290 VSAILIISELNSLHGASWVSVSRE-DTNKATFCGRXVVGTWVKRRRGPKHLQEKLLRRCV 466 ++ + + LN+LH + + E + F +VGTW + L+E C Sbjct: 161 ITKLTAMGVLNNLHDPEYSARENELRALSSLFSKGCLVGTWSPDPAINRRLKETYSNMCA 220 Query: 467 LYSSIQIC 490 L ++C Sbjct: 221 LCEKPEVC 228 >AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced protein 75 protein. Length = 58 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 131 GSVLMEQQGSGNIISEDSGQFGYGRKESNHSFYR 232 GS EQQ SG+I+S S +++S YR Sbjct: 10 GSSAEEQQPSGDILSPSSEPLDNDKEQSAQVCYR 43 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 131 GSVLMEQQGSGNIISEDSGQFGYGRKESNHSFYR 232 GS EQQ SG+I+S S +++S YR Sbjct: 10 GSSAEEQQPSGDILSPSSEPLDNDKEQSAQVCYR 43 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 120 QKDQAPY*WSSKVVATSSARTPVNLDTAGKNPIIRFTVPEFSCS 251 Q+ Q + + A+ + + V LD A K+P+ + E +CS Sbjct: 458 QQQQQHWPMEEEPAASWGSASDVTLDEAVKSPLGSVSSTESTCS 501 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 488 CKCRFG--RSXRERCTPSSMC 544 C CR G R+ ++ C P S C Sbjct: 71 CVCRLGYLRNKKKVCVPRSKC 91 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 488 CKCRFG--RSXRERCTPSSMC 544 C CR G R+ ++ C P S C Sbjct: 71 CVCRLGYLRNKKKVCVPRSKC 91 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 39 FLTISSSTPGITGFISTVEEGATNV*SQKDQA 134 F+TI+ GI GF+ST +E KDQ+ Sbjct: 153 FVTINYRL-GILGFLSTEDEVVPGNMGLKDQS 183 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 39 FLTISSSTPGITGFISTVEEGATNV*SQKDQA 134 F+TI+ GI GF+ST +E KDQ+ Sbjct: 24 FVTINYRL-GILGFLSTEDEVVPGNMGLKDQS 54 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 39 FLTISSSTPGITGFISTVEEGATNV*SQKDQA 134 F+TI+ GI GF+ST +E KDQ+ Sbjct: 153 FVTINYRL-GILGFLSTEDEVVPGNMGLKDQS 183 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.4 bits (43), Expect = 8.3 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 119 PERPGSVLMEQQGSGNIISEDSGQFGYGRKESNHSFYRAR 238 PE G ++ G NI+ + G K + FY R Sbjct: 151 PEDYGKRVLSMDGYQNILDKKDELLGEWEKRAPMGFYGTR 190 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 21.4 bits (43), Expect = 8.3 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 119 PERPGSVLMEQQGSGNIISEDSGQFGYGRKESNHSFYRAR 238 PE G ++ G NI+ + G K + FY R Sbjct: 151 PEDYGKRVLSMDGYQNILDKKDELLGEWEKRAPMGFYGTR 190 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.4 bits (43), Expect = 8.3 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 119 PERPGSVLMEQQGSGNIISEDSGQFGYGRKESNHSFYRAR 238 PE G ++ G NI+ + G K + FY R Sbjct: 151 PEDYGKRVLSMDGYQNILDKKDELLGEWEKRAPMGFYGTR 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,009 Number of Sequences: 438 Number of extensions: 3481 Number of successful extensions: 20 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -