BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0227.Seq (928 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 25 0.97 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 1.7 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 25.0 bits (52), Expect = 0.97 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 285 LLLDQNQSTEASRPKSLILMNLDNFCRSHGQVPAT 181 +L S + P+ L +NL + CR HG PAT Sbjct: 417 VLFPSLDSRDELHPRELEAVNLGSACRIHGS-PAT 450 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.2 bits (50), Expect = 1.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 471 TFLFVFPLTTKYTLTRFVPKLCLANFNNP 557 T+ F +P YT+ F P+ + N+N+P Sbjct: 137 TYNFDYP-QVPYTVKNFHPRCAVNNYNDP 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 252,822 Number of Sequences: 438 Number of extensions: 4945 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30234750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -