BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0220.Seq (903 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 53 4e-09 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 5.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 8.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 52.8 bits (121), Expect = 4e-09 Identities = 24/55 (43%), Positives = 33/55 (60%) Frame = +1 Query: 343 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G+ Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGR 234 Score = 27.9 bits (59), Expect = 0.13 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 504 KDLVGVPKTGSGKTLAYILPAI 569 +DL+ +TGSGKT A+ +P I Sbjct: 234 RDLMACAQTGSGKTAAFAVPII 255 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 5.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 751 PGLLSFRNHHQTHTCYEH 698 P L+ + HHQ HT + H Sbjct: 161 PPLVESQMHHQMHTQHPH 178 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 8.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 903 PQYPNIRSTLHQEPKI 856 PQYP+ S + Q+P I Sbjct: 440 PQYPSTSSHILQQPSI 455 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 251,411 Number of Sequences: 438 Number of extensions: 5995 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -