BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0199 (436 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 25 0.48 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 2.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 4.5 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 4.5 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 6.0 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 6.0 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.9 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 7.9 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 24.6 bits (51), Expect = 0.48 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 113 HLPLSIKTTGFSAGLYSCSLAATKE 39 H PLS+K G GL LA T + Sbjct: 319 HTPLSVKFPGMGHGLQPPDLAGTSQ 343 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 2.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 291 DGVYHPFRAAF*TPRF*GASFRRHPSAARGLPPST 187 + VY+P P++ A F + PS A PS+ Sbjct: 323 NAVYNPIVYGISHPKYRAALFAKFPSLACAAEPSS 357 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 107 PLSIKTTGFSAGLYSCSLAATKE 39 P TTGFS Y C + KE Sbjct: 79 PSVASTTGFSKECYCCRESYLKE 101 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 107 PLSIKTTGFSAGLYSCSLAATKE 39 P TTGFS Y C + KE Sbjct: 79 PSVASTTGFSKECYCCRESYLKE 101 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 157 ARSRRDEKAEPPEHHISRYRLKQRD 83 A++ +D + PE+ S YRL + D Sbjct: 89 AQTWKDNRLRLPENMTSEYRLLEVD 113 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 127 PPEHHISRYRLKQRD 83 PP+ IS YR +RD Sbjct: 127 PPQEVISHYRRTRRD 141 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 20.6 bits (41), Expect = 7.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 160 LARSRRDEKAEPPEHHISRYRLKQRD 83 LA+S RD + PE+ YR+ D Sbjct: 57 LAQSWRDSRLRLPENMSEDYRILDVD 82 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 368 HISPHNISGSIKL*TLGGL 424 H+ H+ +GS+ + +GGL Sbjct: 193 HVHFHDYTGSVVIHVVGGL 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,361 Number of Sequences: 438 Number of extensions: 2764 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -