SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    23   1.8  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    22   4.1  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              21   7.1  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = +1

Query: 406 WEEHFSLPMSGTVNEDSLCLEV 471
           WE+H S P+  +      CL V
Sbjct: 688 WEDHASSPLEPSAVPSKFCLSV 709


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -3

Query: 430 WVKKNVLPKQDLEF 389
           W+++NVL KQ + F
Sbjct: 183 WMRRNVLNKQHVHF 196


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.0 bits (42), Expect = 7.1
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = +2

Query: 26  EPDEHDKIGRIIEAVGWNIDXXXXXXXXXXXHNVGG 133
           +PD++D IG   + +  N+D            ++GG
Sbjct: 446 QPDKYDLIGNGTKLIIKNVDYADTGAYMCQASSIGG 481


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,100
Number of Sequences: 438
Number of extensions: 2768
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 13618701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).