SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex det...    25   0.67 
DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex det...    25   0.67 
DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex det...    25   0.67 
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    25   0.67 
DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex det...    25   0.89 
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    23   3.6  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    23   3.6  

>DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 25.0 bits (52), Expect = 0.67
 Identities = 22/88 (25%), Positives = 37/88 (42%)
 Frame = -3

Query: 293 ELTVERRSYRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAA 114
           E T  +R  R      K  +++ + RK R   +    D  R  R  S+    I ++    
Sbjct: 32  ERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKT 89

Query: 113 LY*NTNSLKRT*RTNIDQTRHRPHPLPV 30
           ++ N N+ K+    NI+     P P+PV
Sbjct: 90  IHNNNNNYKKLQYYNINYIEQIPVPVPV 117


>DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 25.0 bits (52), Expect = 0.67
 Identities = 22/88 (25%), Positives = 37/88 (42%)
 Frame = -3

Query: 293 ELTVERRSYRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAA 114
           E T  +R  R      K  +++ + RK R   +    D  R  R  S+    I ++    
Sbjct: 32  ERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKT 89

Query: 113 LY*NTNSLKRT*RTNIDQTRHRPHPLPV 30
           ++ N N+ K+    NI+     P P+PV
Sbjct: 90  IHNNNNNYKKLQYYNINYIEQIPVPVPV 117


>DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 25.0 bits (52), Expect = 0.67
 Identities = 22/88 (25%), Positives = 37/88 (42%)
 Frame = -3

Query: 293 ELTVERRSYRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAA 114
           E T  +R  R      K  +++ + RK R   +    D  R  R  S+    I ++    
Sbjct: 32  ERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKT 89

Query: 113 LY*NTNSLKRT*RTNIDQTRHRPHPLPV 30
           ++ N N+ K+    NI+     P P+PV
Sbjct: 90  IHNNNNNYKKLQYYNINYIEQIPVPVPV 117


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 25.0 bits (52), Expect = 0.67
 Identities = 22/88 (25%), Positives = 37/88 (42%)
 Frame = -3

Query: 293 ELTVERRSYRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAA 114
           E T  +R  R      K  +++ + RK R   +    D  R  R  S+    I ++    
Sbjct: 265 ERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKT 322

Query: 113 LY*NTNSLKRT*RTNIDQTRHRPHPLPV 30
           ++ N N+ K+    NI+     P P+PV
Sbjct: 323 IHNNNNNYKKLQYYNINYIEQIPVPVPV 350


>DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex
           determiner protein.
          Length = 176

 Score = 24.6 bits (51), Expect = 0.89
 Identities = 21/88 (23%), Positives = 37/88 (42%)
 Frame = -3

Query: 293 ELTVERRSYRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAA 114
           E T  +R  R      K  +++ + RK R   +    D  R  R  S+    I ++    
Sbjct: 32  ERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRD--RKERERSKEPKIISSLSNKT 89

Query: 113 LY*NTNSLKRT*RTNIDQTRHRPHPLPV 30
           ++ N N+ K+    NI+     P P+P+
Sbjct: 90  IHNNNNNYKKLQYYNINYIEQIPVPVPI 117


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +3

Query: 36  KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 134
           K +RPV    DV  +C   ++S LI   LKN I
Sbjct: 42  KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +3

Query: 36  KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 134
           K +RPV    DV  +C   ++S LI   LKN I
Sbjct: 42  KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,963
Number of Sequences: 438
Number of extensions: 3955
Number of successful extensions: 11
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20830365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).