SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    25   0.67 
AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     23   3.6  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   4.7  
DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein ...    21   8.3  
AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein ...    21   8.3  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   8.3  

>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 25.0 bits (52), Expect = 0.67
 Identities = 15/49 (30%), Positives = 20/49 (40%)
 Frame = +3

Query: 450 GGEFDWGGTSVNE*RRCPKAAQRGQKPRVEQKGKSWLDPDVQYA*GLRK 596
           GG+ DW   + NE   C         PR +  G + L   + Y  G RK
Sbjct: 119 GGDLDWKYYTTNESHACLSTGGSCYWPRGKNLGGTTLHHGMAYHRGHRK 167


>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = +1

Query: 460 LTGAVHLSTNNAGVLRQLSED 522
           L G  +  T+ AGV+++L+ED
Sbjct: 225 LFGDFNFRTDTAGVIKKLTED 245


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +1

Query: 268 SSLKNHYFHCFITYSVGRK 324
           SS    +FHC+     GRK
Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438


>DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein 1
           protein.
          Length = 116

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = +1

Query: 262 ARSSLKNHYFHCFI 303
           A   L+N Y+ CFI
Sbjct: 37  ANDRLRNQYYDCFI 50


>AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein
           protein.
          Length = 116

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = +1

Query: 262 ARSSLKNHYFHCFI 303
           A   L+N Y+ CFI
Sbjct: 37  ANDRLRNQYYDCFI 50


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -1

Query: 243 ATPLMSPYNARLESSSTGSSFP 178
           A  + SP   +   SSTGSS P
Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,234
Number of Sequences: 438
Number of extensions: 4322
Number of successful extensions: 9
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20830365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).