SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        27   0.14 
AB183889-1|BAD86829.1|  316|Apis mellifera Mos protein.                22   6.8  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   9.0  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 27.5 bits (58), Expect = 0.14
 Identities = 17/84 (20%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = -1

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG-VLNGDERFRH 344
           G+ Q C  +P   S+ + L+   +  +  +   Q NSP  +   P H+G   +     R 
Sbjct: 25  GTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAART 84

Query: 343 VTTLHAWNETPCARRYYRPRTASA 272
            ++++ +     A  +++ + A A
Sbjct: 85  TSSMYPYVSAAAAHHHHQQQQAVA 108


>AB183889-1|BAD86829.1|  316|Apis mellifera Mos protein.
          Length = 316

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = -2

Query: 231 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 121
           +D R   SP   TP+ + Y   +E+ +  S F  D+P
Sbjct: 21  NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -2

Query: 198 ATPLMSPYNARLESSSTGSSFP 133
           A  + SP   +   SSTGSS P
Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 209,513
Number of Sequences: 438
Number of extensions: 4697
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).