SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0085
         (691 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    23   2.7  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    23   2.7  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    23   2.7  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    23   2.7  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        23   3.6  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        23   3.6  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        23   3.6  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    22   4.8  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   4.8  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   4.8  
DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex det...    21   8.4  
DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex det...    21   8.4  
DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex det...    21   8.4  
DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex det...    21   8.4  
DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex det...    21   8.4  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    21   8.4  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   8.4  

>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 97  NYNNYNKHNYNKLYYNINY 115


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 330 NYNNYNKHNYNKLYYNINY 348


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +3

Query: 453 NYELFNRNNFSIRYWSWNY 509
           NY  +N++N++  Y++ NY
Sbjct: 330 NYNNYNKHNYNKLYYNINY 348


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%)
 Frame = +2

Query: 140 VAIRMPPVIPINH-----YLGVLKTN 202
           +A+  PPV+P NH     YL V++ N
Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%)
 Frame = +2

Query: 140 VAIRMPPVIPINH-----YLGVLKTN 202
           +A+  PPV+P NH     YL V++ N
Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%)
 Frame = +2

Query: 140 VAIRMPPVIPINH-----YLGVLKTN 202
           +A+  PPV+P NH     YL V++ N
Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = -3

Query: 128 NSWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           N  +VAR   A  F   V IN+     +  R+   L+ T+N
Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/17 (41%), Positives = 12/17 (70%)
 Frame = -2

Query: 117  RRKTNISESICQRCFHQ 67
            RR+ N++E++C   F Q
Sbjct: 966  RRRLNVNETVCSDYFSQ 982


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = -2

Query: 672  SKEGSRRANYPLPARGGSDEK*RYG 598
            +K  S+ AN P PA GG   + + G
Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038


>DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +3

Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509
           S ++  NY  +N NN+    ++ NY
Sbjct: 84  SLSNNYNYSNYNNNNYKQLCYNINY 108


>DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +3

Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509
           S ++  NY  +N NN+    ++ NY
Sbjct: 84  SLSNNYNYSNYNNNNYKQLCYNINY 108


>DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +3

Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509
           S ++  NY  +N NN+    ++ NY
Sbjct: 84  SLSNNYNYSNYNNNNYKQLCYNINY 108


>DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +3

Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509
           S ++  NY  +N NN+    ++ NY
Sbjct: 84  SLSNNYNYSNYNNNNYKQLCYNINY 108


>DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +3

Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509
           S ++  NY  +N NN+    ++ NY
Sbjct: 84  SLSNNYNYSNYNNNNYKQLCYNINY 108


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = -2

Query: 339 YRGALR*VSRWADNFTLNKLECSKRAKNVLE 247
           Y G LR  S + ++   N  E   + KNVL+
Sbjct: 424 YAGLLRNRSEYLNHLRANVAEGRNQRKNVLD 454


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 8/27 (29%), Positives = 14/27 (51%)
 Frame = +1

Query: 559 LKCTHSDYEARKSPVSLFFVTTSPCRE 639
           L+C  S+Y   + P +    TT+  R+
Sbjct: 769 LQCATSNYSTTRWPATSVITTTTGARQ 795


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,063
Number of Sequences: 438
Number of extensions: 4604
Number of successful extensions: 29
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21073995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).