SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    23   3.2  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   5.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   5.7  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +2

Query: 20  MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 154
           M  C P   DT    +Y+F   R Y +   T VI  +   + TLT
Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +1

Query: 406  RQQARKLPTPGTGGSDE 456
            R+Q RK  TPG   SDE
Sbjct: 1768 RRQQRKQQTPGDVESDE 1784


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +1

Query: 406  RQQARKLPTPGTGGSDE 456
            R+Q RK  TPG   SDE
Sbjct: 1764 RRQQRKQQTPGDVESDE 1780


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,496
Number of Sequences: 438
Number of extensions: 3870
Number of successful extensions: 8
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18826962
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).