SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    23   3.2  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    22   4.2  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   5.5  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   9.6  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   9.6  

>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = +3

Query: 243 LEAFGIIPRMVASHHRPLGRVHEPNVR 323
           L  +G I  ++AS HR L      NVR
Sbjct: 215 LYVYGRISCVIASRHRNLEATESENVR 241


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 8/24 (33%), Positives = 14/24 (58%)
 Frame = +1

Query: 280 RTTGRSAECMNQMSETAVPLVLSS 351
           +  G+  +C N MSE  V ++L +
Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 12/28 (42%), Positives = 14/28 (50%)
 Frame = -3

Query: 327 SFGHLVHALGRAAGGAKLPSAGLCRTPL 244
           S   LV A+   AGG   PSAG    P+
Sbjct: 393 SMSALVSAVRSPAGGQLPPSAGAPMPPI 420


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 11/31 (35%), Positives = 14/31 (45%)
 Frame = -2

Query: 256 PNASKAEASLAESGKDMLTVEPRESGGSKQC 164
           PNAS + A    S   +    P+ S G  QC
Sbjct: 741 PNASPSPAEQCASTTTITARSPQGSQGLLQC 771


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = +1

Query: 394 LSHDGLIPAHVPF*WVNNPT 453
           +SH   +  HVP  W+  PT
Sbjct: 694 VSHTQRLVVHVPPRWIVEPT 713


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,076
Number of Sequences: 438
Number of extensions: 3414
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18337950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).