SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    23   3.3  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   4.3  
DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein ...    22   5.7  
AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein ...    22   5.7  
DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    21   7.5  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    21   9.9  
AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        21   9.9  

>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/22 (31%), Positives = 13/22 (59%)
 Frame = -2

Query: 288 QCQTRVKLNRVSFPADSPKPVP 223
           +CQ    ++ + +P   PKP+P
Sbjct: 28  ECQATPVIHFLQYPGCVPKPIP 49


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +1

Query: 337 SSLKNHYFHCFITYSVGRK 393
           SS    +FHC+     GRK
Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438


>DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein 1
           protein.
          Length = 116

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +1

Query: 316 VGDRFARSSLKNHYFHCFI 372
           + +  A   L+N Y+ CFI
Sbjct: 32  IDEILANDRLRNQYYDCFI 50


>AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein
           protein.
          Length = 116

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +1

Query: 316 VGDRFARSSLKNHYFHCFI 372
           + +  A   L+N Y+ CFI
Sbjct: 32  IDEILANDRLRNQYYDCFI 50


>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = -2

Query: 603 REVSVLAELALGHLRYSLTDVPPQSNSPH 517
           ++ SVL     G L+Y ++D    +N  H
Sbjct: 430 KKSSVLVHTKNGRLKYQISDNDISTNETH 458


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = +2

Query: 224 GTGLGESAGKETLLSLTLV 280
           G GLG ++G   +LSL +V
Sbjct: 49  GGGLGIASGLSAMLSLVVV 67


>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 10/38 (26%), Positives = 18/38 (47%)
 Frame = -2

Query: 633 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 520
           G+ Q C  +P   S+ + L+   +  +  +   Q NSP
Sbjct: 25  GTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSP 62


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,752
Number of Sequences: 438
Number of extensions: 3679
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18949215
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).