SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    23   3.1  
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    22   5.4  
X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.    21   9.4  
EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2 prot...    21   9.4  
AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2 prot...    21   9.4  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +3

Query: 18  MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 152
           M  C P   DT    +Y+F   R Y +   T VI  +   + TLT
Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 10/45 (22%), Positives = 25/45 (55%)
 Frame = -2

Query: 259 DQRSAKVIQIHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACIS 125
           D++      I+Q   L  +   +IG+ + +  +PS++ V+++ +S
Sbjct: 218 DRKEKLATGIYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVS 262


>X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.
          Length = 162

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +1

Query: 436 HGSFSGLPGPLGQGEHADS 492
           HG+ S  P  LG+ +H D+
Sbjct: 39  HGNKSSGPNELGRFKHTDA 57


>EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +1

Query: 436 HGSFSGLPGPLGQGEHADS 492
           HG+ S  P  LG+ +H D+
Sbjct: 44  HGNKSSGPNELGRFKHTDA 62


>AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +1

Query: 436 HGSFSGLPGPLGQGEHADS 492
           HG+ S  P  LG+ +H D+
Sbjct: 44  HGNKSSGPNELGRFKHTDA 62


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,973
Number of Sequences: 438
Number of extensions: 3534
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17848938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).