SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             27   0.23 
EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    23   3.7  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          22   6.5  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 26.6 bits (56), Expect = 0.23
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = -1

Query: 535  PKRPQPILKFKWVRTPAYS--NDEAGDLMTVPSGPILVSRTGA 413
            P+RP+ +       +P+    ND+  D +T P  P+ +SR G+
Sbjct: 1366 PERPERVPTVDLSPSPSDRGRNDDGSDRLTSPPTPLSISRAGS 1408


>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 11/37 (29%), Positives = 18/37 (48%)
 Frame = -3

Query: 302 AKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF 192
           +K+ A     K    K   +   ++ +PLP RV+ NF
Sbjct: 199 SKKLAKAAASKAALAKLRNVHSSSFCIPLPVRVLPNF 235


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 14/38 (36%), Positives = 18/38 (47%)
 Frame = +3

Query: 93  ICTDGGSKRAHAQTLLRSPSRTSYSLRLNDTKLKI*HH 206
           +C    S+       L SP R   + R+N TKLK  HH
Sbjct: 120 LCEVPESRDGPPSVSLSSPPREPGTPRINFTKLKR-HH 156


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 202,661
Number of Sequences: 438
Number of extensions: 4274
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21561255
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).