SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    23   3.3  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    22   5.7  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    22   5.7  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    22   5.7  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    22   5.7  
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     22   5.7  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                22   5.7  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    21   7.6  

>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%)
 Frame = -3

Query: 97  DKQHPELQSLRK--HITACFSELACFLMPHP 11
           DK  P L   R+  + TAC   LAC L P+P
Sbjct: 195 DKVAPILVRARETPNYTACPPTLACPLNPNP 225


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 619 EPSGKESPSYWTSS 578
           E SGKES  Y TSS
Sbjct: 190 EKSGKESKKYATSS 203


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 619 EPSGKESPSYWTSS 578
           E SGKES  Y TSS
Sbjct: 201 EKSGKESKKYATSS 214


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 619 EPSGKESPSYWTSS 578
           E SGKES  Y TSS
Sbjct: 201 EKSGKESKKYATSS 214


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 619 EPSGKESPSYWTSS 578
           E SGKES  Y TSS
Sbjct: 190 EKSGKESKKYATSS 203


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/37 (27%), Positives = 16/37 (43%)
 Frame = -3

Query: 163 PYEAPYGADGGMQILSRRLKVSDKQHPELQSLRKHIT 53
           PY  P G+ G    L      S +    +Q+LR  ++
Sbjct: 381 PYGYPIGSGGSFPSLYPMATTSPQSQSTIQTLRPQVS 417


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 11/34 (32%), Positives = 15/34 (44%)
 Frame = -3

Query: 274 GRPPAPSLFTEYGRLALEDGGRTPFQRLQFLVRD 173
           G P AP++  E G       G  PF  L   +R+
Sbjct: 46  GTPAAPNMPAEEGEGMAGVTGEEPFDTLDTFLRE 79


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 6/16 (37%), Positives = 11/16 (68%)
 Frame = +2

Query: 458 MPVVSLSEPPRQLKPW 505
           +P+   + PPR ++PW
Sbjct: 367 VPIYCGNFPPRSMEPW 382


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,439
Number of Sequences: 438
Number of extensions: 3603
Number of successful extensions: 13
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19071468
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).