SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    25   0.23 
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    25   0.31 
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      23   0.32 
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   1.6  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    22   2.9  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    21   3.8  
S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    21   5.0  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          20   8.7  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          20   8.7  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          20   8.7  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          20   8.7  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          20   8.7  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          20   8.7  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          20   8.7  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    20   8.7  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 25.4 bits (53), Expect = 0.23
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 5/60 (8%)
 Frame = +2

Query: 134 PDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGK-----SHDEPRRHQNQRQSEKSAR 298
           PD+      QM    H  T+ P  Q  QG  QS  +     +H++   +Q Q+QS+ +++
Sbjct: 158 PDSPPLVESQMHHQMH--TQHPHMQPQQGQHQSQAQQQHLQAHEQHMMYQQQQQSQAASQ 215


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 25.0 bits (52), Expect = 0.31
 Identities = 9/20 (45%), Positives = 16/20 (80%)
 Frame = +1

Query: 280 EREIGKRTTRRK*YGGILNL 339
           ++E+ +R +RRK YGG+ +L
Sbjct: 257 QKELVRRDSRRKNYGGVYHL 276


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 22.6 bits (46), Expect(2) = 0.32
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 281 SEKSARGRLVESSMAVS*TYS*M*H*KLSYLFEV 382
           SE++ R  ++ +    S + S M H KLSY F V
Sbjct: 322 SERNPRSAVLAAREITSSSCSYMAHEKLSYAFSV 355



 Score = 20.6 bits (41), Expect(2) = 0.32
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +2

Query: 116 KIIVLLPDNKRSKIEQM 166
           KII  LP +K SKI+ +
Sbjct: 278 KIIPTLPSDKLSKIQTL 294


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 22.6 bits (46), Expect = 1.6
 Identities = 13/37 (35%), Positives = 15/37 (40%)
 Frame = +2

Query: 206 QKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGRLVES 316
           Q  +G P     + D P  HQN     KS  G  V S
Sbjct: 215 QPGEGLPMWKSDTSDGPESHQNS-NVPKSVAGLNVSS 250


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 21.8 bits (44), Expect = 2.9
 Identities = 8/31 (25%), Positives = 18/31 (58%)
 Frame = +3

Query: 249 TNQDGTKISGRARNRQEDDSSKVVWRYLELI 341
           T  D   I+  A+N+ + +S +  W+Y+ ++
Sbjct: 515 TIDDARFIAQHAKNKDKFESVEEDWKYVAMV 545


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 21.4 bits (43), Expect = 3.8
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = -1

Query: 71  PPKRHHDVIWSEILK 27
           PP  H   +W E+LK
Sbjct: 149 PPYSHQTDVWVELLK 163


>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 21.0 bits (42), Expect = 5.0
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = -2

Query: 295 CRFLALPLILVPSWFV 248
           C F  L +IL+ S+FV
Sbjct: 7   CTFFFLSVILITSYFV 22


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSH 247
           + K+   +EL+  + K  S +    +P+S G+S+
Sbjct: 56  KKKMILEYELRRAREKKLSKRSKSRSPESRGRSN 89


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,247
Number of Sequences: 438
Number of extensions: 1840
Number of successful extensions: 16
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used:  9514659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).