SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    25   0.72 
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    25   0.72 
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    23   3.8  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    22   5.1  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        21   8.9  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        21   8.9  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        21   8.9  

>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 25.0 bits (52), Expect = 0.72
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = -3

Query: 592  DVRLATIQEFHL*RRNTNA--PSYPY*SLPGVLKTNKIEPRSYSIIPCTKYS 443
            ++R   IQ F++  R T++  PSY + S+ G  +    E R   + P TKY+
Sbjct: 1033 ELRHGDIQGFNVGYRETSSSNPSYNFSSVSGDGEEGGAELRLTGLRPYTKYT 1084



 Score = 21.8 bits (44), Expect = 6.7
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +1

Query: 28   RQQARKLPTPGTGGSDE 78
            R+Q RK  TPG   SDE
Sbjct: 1768 RRQQRKQQTPGDVESDE 1784


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 25.0 bits (52), Expect = 0.72
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = -3

Query: 592  DVRLATIQEFHL*RRNTNA--PSYPY*SLPGVLKTNKIEPRSYSIIPCTKYS 443
            ++R   IQ F++  R T++  PSY + S+ G  +    E R   + P TKY+
Sbjct: 1029 ELRHGDIQGFNVGYRETSSSNPSYNFSSVSGDGEEGGAELRLTGLRPYTKYT 1080



 Score = 21.8 bits (44), Expect = 6.7
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +1

Query: 28   RQQARKLPTPGTGGSDE 78
            R+Q RK  TPG   SDE
Sbjct: 1764 RRQQRKQQTPGDVESDE 1780


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = +3

Query: 564 NSWIVARRTSAKAFAKGVFINQERKLEVRKRLDTALVLTVN 686
           N  +VAR   A  F   V IN+     +  R+   L+ T+N
Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 7/17 (41%), Positives = 12/17 (70%)
 Frame = +2

Query: 575  RRKTNISESICQRCFHQ 625
            RR+ N++E++C   F Q
Sbjct: 966  RRRLNVNETVCSDYFSQ 982


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 552 VAIRMPPVIPINH 514
           +A+  PPV+P NH
Sbjct: 353 LAVPAPPVLPENH 365


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 552 VAIRMPPVIPINH 514
           +A+  PPV+P NH
Sbjct: 353 LAVPAPPVLPENH 365


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 552 VAIRMPPVIPINH 514
           +A+  PPV+P NH
Sbjct: 353 LAVPAPPVLPENH 365


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 200,150
Number of Sequences: 438
Number of extensions: 4483
Number of successful extensions: 15
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22292145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).